Search results for "Firmware"

showing 7 items of 27 documents

Implementation of a PLC Field Analyzer on a G3 Modem Platform

2021

Nowadays, power line communications (PLC) are a widely used technology in distribution grids, both for automatic meter reading and automation applications. PLC performances (in terms of capacity, coverage, robustness, and data transmission rate) can be significantly affected by electrical network topologies, connected loads and disturbances. Thus, utilities and modem manufacturers are increasing their interest in electrical network characterization. In this framework, a software tool is proposed in this paper to measure received signal and noise levels. As case study, it is implemented on a G3 PLC transceiver, widely used for smart metering purposes. In this way, a PLC channel characterizat…

business.industryFirmwarecomputer.software_genreNetwork topologyCommunication signal communication systems power line communication Power system communication power system measurements smart gridslaw.inventionTransmission (telecommunications)lawElectrical networkMedicineTransceiverbusinesscomputerSettore ING-INF/07 - Misure Elettriche E ElettronicheComputer hardwareAutomatic meter readingCommunication channelData transmission
researchProduct

Development of the optical multiplexer board prototype for data acquisition in TileCal experiment

2005

The optical multiplexer board is one of the elements present in the read out chain of the tile calorimeter in ATLAS experiment. Due to radiation effects, two optical fibers with the same data come out from the front end boards to this board, which has to decide in real time which one carries good data and pass them to the read out driver motherboard for processing. This paper describes the design and tests of the first prototype, implemented as a 6U VME64x slave module, including both hardware and firmware aspects. In this last, algorithms for cyclic redundancy code checking are used to make the decision. Besides, the board may be used as a data injector for testing purposes of the read out…

business.industryMotherboardFirmwareComputer scienceATLAS experimentcomputer.software_genreMultiplexerFront and back endsData acquisitionEmbedded systemCyclic redundancy checkCode (cryptography)businesscomputerComputer hardware14th IEEE-NPSS Real Time Conference, 2005.
researchProduct

A new ATLAS muon CSC readout system with system on chip technology on ATCA platform

2015

The ATLAS muon Cathode Strip Chamber (CSC) backend readout system has been upgraded during the LHC 2013-2015 shutdown to be able to handle the higher Level-1 trigger rate of 100 kHz and the higher occupancy at Run 2 luminosity. The readout design is based on the Reconfigurable Cluster Element (RCE) concept for high bandwidth generic DAQ implemented on the Advanced Telecommunication Computing Architecture (ATCA) platform. The RCE design is based on the new System on Chip XILINX ZYNQ series with a processor-centric architecture with ARM processor embedded in FPGA fabric and high speed I/O resources together with auxiliary memories to form a versatile DAQ building block that can host applicati…

business.product_categoryLarge Hadron Collider010308 nuclear & particles physicsbusiness.industryFirmwareComputer scienceElectronic detector readout concepts (gas liquid)Data acquisition conceptscomputer.software_genre01 natural sciencesARM architectureData acquisition0103 physical sciencesNetwork switchSystem on a chipModular electronics010306 general physicsbusinessField-programmable gate arrayInstrumentationHost (network)computerParticle Physics - ExperimentMathematical PhysicsComputer hardwareJournal of Instrumentation
researchProduct

A High speed data link optimization for digitalized transfer to processing FPGA

2021

State-of-the-art arrays of detectors, that require digital processing, may have a sizeable number of digitalized signal links. This is the case in several experimental nuclear physics instruments. Moreover, the data rate of the sampled signals, defined primary by the signal bandwidth of the individual detectors, may not exhaust the capabilities of a single FPGA transceiver input. The preprocessing is usually carried out in a modern FPGA with transceiver data rate capabilities over 10Gbps. Moreover, cost effective FPGA have a limited number of transceivers for given FPGA processing capabilities. The investigation of a cost-effective and efficient solution to the mismatch between both data ra…

communication serial linkMotherboardComputer scienceFirmwarebusiness.industryInterface (computing)PhysicsQC1-999computer.software_genreLink aggregationelectronic instrumentationData linktime domain multiplexingfpga optimizationTransceiverField-programmable gate arrayCommunications protocolbusinesscomputerComputer hardwareEPJ Web of Conferences
researchProduct

Towards Automated Classification of Firmware Images and Identification of Embedded Devices

2017

Part 4: Operating System and Firmware Security; International audience; Embedded systems, as opposed to traditional computers, bring an incredible diversity. The number of devices manufactured is constantly increasing and each has a dedicated software, commonly known as firmware. Full firmware images are often delivered as multiple releases, correcting bugs and vulnerabilities, or adding new features. Unfortunately, there is no centralized or standardized firmware distribution mechanism. It is therefore difficult to track which vendor or device a firmware package belongs to, or to identify which firmware version is used in deployed embedded devices. At the same time, discovering devices tha…

sulautettu tietotekniikkaComputer scienceVendorvulnerability02 engineering and technologycomputer.software_genreSoftware020204 information systems0202 electrical engineering electronic engineering information engineering[INFO]Computer Science [cs]tietoturvadata securityhaavoittuvuusbusiness.industryFirmwareFingerprint (computing)020206 networking & telecommunicationsubiquitous computingRandom forestIdentification (information)koneoppiminenmachine learningEmbedded systemUser interfaceHardware_CONTROLSTRUCTURESANDMICROPROGRAMMINGbusinesscomputerPrivate network
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Data mining framework for random access failure detection in LTE networks

2014

Sleeping cell problem is a particular type of cell degradation. There are various software and hardware reasons that might cause such kind of cell outage. In this study a cell becomes sleeping because of Random Access Channel (RACH) failure. This kind of network problem can appear due to misconfiguration, excessive load or software/firmware problem at the Base Station (BS). In practice such failure might cause network performance degradation, which is hardly traceable by an operator. In this paper we present a data mining based framework for the detection of problematic cells. In its core is the analysis of event sequences reported by a User Equipment (UE) to a serving BS. The choice of N i…

ta113sleeping cell problembusiness.industryComputer scienceFirmwareHeuristic (computer science)Event (computing)Reliability (computer networking)data miningLTE networkscomputer.software_genreBase stationRandom-access channelUser equipmentData miningbusinessrandom access channelcomputerRandom accessComputer network2014 IEEE 25th Annual International Symposium on Personal, Indoor, and Mobile Radio Communication (PIMRC)
researchProduct