Search results for "Formant"

showing 9 items of 29 documents

Professionals' Views on the Comparatively Low Prevalence of Intimate Partner Violence Against Women in Spain.

2021

The aim of this study was to understand the reasons why Spain has one of the lowest prevalence rates of intimate partner violence against women (IPVAW) in the European Union. Using a qualitative and inductive research approach, a total of five focus groups ( n = 19) and 10 unstructured interviews with key informants were conducted. Three main categories were identified as possible explanations of the relatively low prevalence of IPVAW in Spain: law and policy, social awareness, and cultural patterns. Lessons learned and implications to improve future macrolevel intervention and prevention strategies are discussed.

Sociology and Political SciencePrevalenceIntimate Partner Violence050109 social psychologyDevelopmental psychologyGender StudiesIntervention (counseling)Prevalencemedia_common.cataloged_instanceHumans0501 psychology and cognitive sciencesSocial consciousnessEuropean unionmedia_common050901 criminology05 social sciencesFocus GroupsFocus groupSexual PartnersKey informantsSpainDomestic violenceFemale0509 other social sciencesPsychologyLawQualitative researchViolence against women
researchProduct

Estudio de las mucinas ancladas a membrana como diana farmacológica en la fibrosis pulmonar

2020

Antecedentes: La fibrosis pulmonar idiopática (FPI) es una enfermedad pulmonar intersticial fibrosante y crónica de etiología desconocida e incurable englobada dentro de las enfermedades raras. Varias mucinas han demostrados estar implicadas en esta enfermedad, sin embargo, no hay evidencia hasta la fecha sobre el papel de la mucina anclada a membrana MUC4 en el desarrollo de FPI. Objetivo: Evaluar la sobreexpresión y localización de MUC4 en el tejido pulmonar de pacientes con FPI asi como caracterizar su posible implicación en la activación y transformaciones celulares que participan en la FPI (proliferación de fibroblastos, senescencia, transición epitelio mesénquima y transición fibrobla…

UNESCO::CIENCIAS MÉDICAS ::Farmacología ::Análisis de medicamentosfactor de crecimiento transformante tipo 1:CIENCIAS MÉDICAS ::Farmacología ::Análisis de medicamentos [UNESCO]fibrosis pulmonarmucina 4
researchProduct

Patskaņu izrunas īpatnības skotu angļu valodā (korpusā SCOTS)

2018

Skotijas vēsture un pašreizējie apstākļi ir multilingvāli un tur lietotā angļu valoda atšķiras no citur lietotajām angļu valodas paveidiem ar tās izrunas modeli. Šī darba mērķis ir patskaņu izpēte skotu standarta angļu valodā, lai raksturotu tās patskaņu sistēmu salīdzinājumā ar standarta britu angļu valodu un novērotu kādas iespējamās līdzības. Šī mērķa sasniegšanai izmantotā metode ir patskaņu formantu akustiskā kvantitatīvā analīze, kurai paraugi ņemti no Skotu Tekstu un Runas Korpusa (Scottish Corpus of Texts&Speech). Pētījuma rezultāti atklāj, ka skotu angļu valodas lietotājiem ir atšķirīgi patskaņu inventāri un patskaņu artikulācijas veids var atšķirties starp dažādām lietotāju grupām…

Valodniecībaspectrogrammonophthongsvowel systemformantsScottish Standard English
researchProduct

Campagne DRADEM – Juillet 2016 - Rapport scientifique

2016

La campagne DRADEM s’est déroulée du 9 au 21 Juillet 2016 à bord du Pourquoi Pas ?, dans les zones économique exclusives du Suriname et de la Guyane. Cette campagne s’inscrit dans un programme d’étude géologique du plateau de Demerara, dans la suite des campagnes GUYAPLAC (2003), IGUANES (2013), et avant MARGATS (2016). Les objectifs de la campagne DRADEM étaient de cartographier la pente continentale de la marge transformante bordant au Nord le Plateau de Demerara, et d’échantillonner par dragage les roches qui y affleurent.La bathymétrie de la totalité de la pente continentale et une partie de la bordure du plateau ont été cartographiées, confirmant la segmentation de cette m…

[SDU.STU.TE]Sciences of the Universe [physics]/Earth Sciences/Tectonicsdragage[SDU.STU.ST]Sciences of the Universe [physics]/Earth Sciences/Stratigraphy[SDU.STU.TE] Sciences of the Universe [physics]/Earth Sciences/Tectonics[SDU.STU.ST] Sciences of the Universe [physics]/Earth Sciences/Stratigraphy[ SDU.STU.TE ] Sciences of the Universe [physics]/Earth Sciences/TectonicsDemerara[ SDU.STU.ST ] Sciences of the Universe [physics]/Earth Sciences/Stratigraphymarge transformante
researchProduct

La ricerca sul campo come extraordinary experience. Una proposta di ricerca multidisciplinare

2010

Reflexive criticism focused its attention on writing texts, neglecting the experience of observation, on which the practice of field research is built, and it rarely paid attention to the experience of researchers. The triple relationship established between the anthropologist, the world and the “other” reveals the deep interrelation between the three levels of this “complex isotopy”. This essay addresses the problem of how a person can interact with another within the ethnographic practice. Ethnographic research doesn’t consist only in dialogues but also in bodily experiences that have a key role in the production of ethnographic representations. Experiential anthropologists believe that w…

informantethnographic fieldworkincorporationSettore M-DEA/01 - Discipline Demoetnoantropologichetheory of knowledgemirror neurons
researchProduct

Multi-informant evaluation in autism spectrum disorder: a review study.

2020

In order to establish a diagnosis of autism spectrum disorder (ASD), assessment by different informants is required. Sometimes, however, there are certain discrepancies between evaluators. With the aim of shedding light on possible discrepancies between informants, this work includes an updated review of the literature to examine the degree of agreement between different informants regarding the characteristic symptomatology of ASD in children and adolescents (up to 17 years of age). A total of 20 studies were analyzed, in which the levels of correlation between the evaluations carried out by different informants were moderate or low. A large part of the studies included in this review foun…

lcsh:Psychologylcsh:BF1-990Autismeautism spectrum disorder (asd). informant agreement. literature review. multi-informant assessment
researchProduct

2021

In vowel discrimination, commonly found discrimination patterns are directional asymmetries where discrimination is faster (or easier) if differing vowels are presented in a certain sequence compared to the reversed sequence. Different models of speech sound processing try to account for these asymmetries based on either phonetic or phonological properties. In this study, we tested and compared two of those often-discussed models, namely the Featurally Underspecified Lexicon (FUL) model (Lahiri and Reetz, 2002) and the Natural Referent Vowel (NRV) framework (Polka and Bohn, 2011). While most studies presented isolated vowels, we investigated a large stimulus set of German vowels in a more n…

media_common.quotation_subjectSpeech recognition05 social sciencesMismatch negativityLexicon050105 experimental psychologyLoudness03 medical and health sciencesBehavioral NeurosciencePsychiatry and Mental health0302 clinical medicineNeuropsychology and Physiological PsychologyFormantNeurologyVowelPerception0501 psychology and cognitive sciencesPsychologySet (psychology)Oddball paradigm030217 neurology & neurosurgeryBiological Psychiatrymedia_commonFrontiers in Human Neuroscience
researchProduct

Espacios y prácticas de participación ciudadana. Propuestas educativas desde una mirada intercultural

2018

El artículo presenta la investigación de tesis doctoral que se ha desarrollado en cuatro espacios de participación ciudadana de la ciudad de Madrid durante tres años (2015/2017).  Consideramos que la ciudadanía se aprende ejerciéndola y que los espacios de participación son escuelas de ciudadanía. La finalidad del estudio es formular propuestas educativas  para el aprendizaje de la ciudadanía activa a partir del análisis de lo que sucede en dichos espacios.  El texto se estructura en torno a estos apartados:  1) reflexiones y premisas en relación a la participación y la educación para la ciudadanía;  2) antecedentes directos de la investigación y las continuidades que se dan en este trabajo…

media_common.quotation_subjectinvestigación educativaParticipant observationActive citizenshipEducationeducación inter-culturalEducational researchKey informantsPedagogyEthnographySociology:PEDAGOGÍA [UNESCO]participación del ciudadanoinvestigación cualitativaUNESCO::PEDAGOGÍACitizenshipeducación cívicaQualitative researchmedia_commonDiversity (politics)
researchProduct

Miten lapsen tarkkaavuuden, keskittymisen ja toiminnanohjauksen ongelmat näkyvät viidessä eri käyttäytymisen arvioinnissa sekä vanhempien ja opettaji…

2017

Tässä tutkimuksessa haluttiin tarkastella Behavioral and Emotional Rating Scale (BERS), Strenghts and Difficulties Questionnaire (SDQ), Viivi (5-15), Home Situation Questionnaire (HSQ) ja School Situation Questionnaire (SSQ) ja Keskittymiskysely (KESKY) kyselylomakkeiden eroja ja yhteyksiä sekä vertailtiin opettajien ja vanhempien tulkintoja lapsen keskittymisen, tarkkaavaisuuden ja toiminnanohjauksen ongelmista. Tämän tutkimuksen aineisto on kerätty osana Jyväskylän yliopiston kasvatustieteiden laitoksen ja Niilo Mäki instituutin Minäpystyvyys ja oppimisvaikeusinterventiot – hanketta syksyllä 2013. Tutkimukseen osallistui 66 lasta, joiden tarkkaavaisuutta, keskittymistä ja toiminnanohjaust…

opettajatoiminnanohjaus (psykologia)vanhemmatkäyttäytymisenarviointivanhempikeskittymiskykytarkkaavaisuustoiminnanohjauskäyttäytyminenopettajatarviointikeskittyminenmulti-informantti
researchProduct