Search results for "Function"

showing 10 items of 14432 documents

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

What Contributes to the Measured Chiral Optical Response of the Glutathione-Protected Au25 Nanocluster?

2023

The water-soluble glutathione-protected [Au25(GSH)18]−1 nanocluster was investigated by integrating several methodologies such as molecular dynamics simulations, essential dynamics analysis, and state-of-the-art time-dependent density functional theory calculations. Fundamental aspects such as conformational, weak interactions and solvent effects, especially hydrogen-bonds, were included and found to play a fundamental role in assessing the optical response of this system. Our analysis demonstrated not only that the electronic circular dichroism is extremely sensitive to the solvent presence but also that the solvent itself plays an active role in the optical activity of such system, formin…

essential dynamicsklusterittiheysfunktionaaliteoriachiralitynanoklusteritnanoclusternanohiukkasetmolekyylidynamiikkagoldthiolsmolecular dynamicsdensity functional theorykulta
researchProduct

Dire estetica, fare estetica con l'architettura

2013

Il saggio affronta il tema del'"estetica realizzata" focalizzandosi sulla maniera peculiare del "fare estetica" nel caso specifico dell'architettura. "Frammenti" della disciplina dell'estetica ricorrono randomicamente nel "discorso" sull'architettura: sia che si tratti di una organica trattazione teorica, sia che si tratti della didattica della progettazione architettonica sia che si tratti dell'interlocuzione tra architetto e cliente. Il progetto infatti si costruisce spesso attraverso un dialogo tra architetto "madre" e cliente "padre" (Filarete, Wright). A tal riguardo l'autore propone originalmente la definizione di progetto di architettura come "atto estetologico diffuso". Successivame…

estetica architettura costruzione funzioneSettore ICAR/14 - Composizione Architettonica E Urbanaaesthetics architecture function
researchProduct

Form follows Function? Misunderstanding and Value of a Sullivan’s Concept

2012

L’attuale dibattito nel campo dell’architettura e del design ha riportato in auge la relazione tra forma e funzione. Per comprendere il significato di questi concetti può essere utile una rilettura storica dei grandi Maestri del Movimento moderno, a partire da Louis H. Sullivan, considerato “il padre” del funzionalismo. Ma al contempo emerge la necessità di interpretare i concetti di “forma” e “funzione” secondo la prospettiva della storia delle idee. Questa chiave di lettura, rivelando la stratificazione semantica che ha determinato nei secoli la complessità delle nozioni di “forma” e “funzione”, dimostra l’erroneità di certe interpretazioni “razionalistiche” e mette in luce la stretta rel…

estetica funzionalismo teoria dell’architettura Sullivan architettura organica form follows function ornamento storia delle ideeSettore M-FIL/04 - Estetica
researchProduct

Poincaré Type Inequalities for Vector Functions with Zero Mean Normal Traces on the Boundary and Applications to Interpolation Methods

2019

We consider inequalities of the Poincaré–Steklov type for subspaces of H1 -functions defined in a bounded domain Ω∈Rd with Lipschitz boundary ∂Ω . For scalar valued functions, the subspaces are defined by zero mean condition on ∂Ω or on a part of ∂Ω having positive d−1 measure. For vector valued functions, zero mean conditions are applied to normal components on plane faces of ∂Ω (or to averaged normal components on curvilinear faces). We find explicit and simply computable bounds of constants in the respective Poincaré type inequalities for domains typically used in finite element methods (triangles, quadrilaterals, tetrahedrons, prisms, pyramids, and domains composed of them). The second …

estimates of constants in functional inequalitiesvektorit (matematiikka)interpolointiPoincaré type inequalitiesinterpolation of functionsfunktiot
researchProduct

Estimates for the Differences of Certain Positive Linear Operators

2020

The present paper deals with estimates for differences of certain positive linear operators defined on bounded or unbounded intervals. Our approach involves Baskakov type operators, the kth order Kantorovich modification of the Baskakov operators, the discrete operators associated with Baskakov operators, Meyer&ndash

estimates of differences of operatorsPure mathematicslcsh:MathematicsGeneral Mathematics010102 general mathematicsLinear operatorsMKZ-operatorsBBH-operatorsType (model theory)lcsh:QA1-93901 natural sciencesModulus of continuity010101 applied mathematicsKantorovich modificationsBaskakov operatorBounded functionBaskakov operatorsComputer Science (miscellaneous)Order (group theory)0101 mathematicsEngineering (miscellaneous)positive linear operatorsMathematicsMathematics
researchProduct

Revista electrónica interuniversitaria de formación del profesorado

2016

La realidad socioeducativa actual demanda de los profesionales de la educación una intervención comprometida y coherente para el desarrollo de competencias y habilidades emocionales. Es necesario complementar lo académico y cuantificable con aquello que sobrepasa las barreras del centro e influye en el rendimiento y desarrollo personal y social del alumnado. Las relaciones que se dan entre los componentes de la triada emoción, pensamiento y acción regulan cada momento de nuestros días, pudiéndose ver estas alteradas negativamente por estímulos externos que en ocasiones, no somos capaces de gestionar adecuadamente. Esta incorrecta gestión emocional tiene su base en un creciente analfabetismo…

estrategia de aprendizajerelaciones interpersonalesRealisationControl (management)Primary educationenseñanza primariaContext (language use)emociónlcsh:Education (General)Educationeducación de la afectividadResource (project management)Action (philosophy)dramatizaciónAprenentatgeIntervention (counseling)PedagogyPsychologylcsh:L7-991Functional illiteracyRevista Electronica Interuniversitaria de Formación del Profesorado
researchProduct

Estrogen regulates muscle bioenergetic signaling

2018

estrogeenitAgingvaihdevuodetBioenergeticsmedicine.drug_classmenopauseBiologyta3111estrogenic regulation03 medical and health sciences0302 clinical medicinemitochondrial functionmedicinelihassolutbioenergetiikkamuscle proteome030304 developmental biology0303 health sciencesta3141Cell Biologymedicine.diseaseCell biologyMuscle proteomeMenopauseikääntyminenEstrogen030220 oncology & carcinogenesisAging
researchProduct

The Greek Verb. Morphology, Syntax, Semantics. Proceedings of the 8th International Meeting on Greek Linguistics. Agrigento, October 1-3, 2009

2014

Despite the difficulties of reconstructing the grammar of a dead language, studying Ancient Greek offers new insights for linguistic theory. The morphological complexity of the Greek verb with its highly intricate inflectional system provide a valuable basis for an in-depth-analysis of the mechanisms which regulate the functioning of a language. Studies on the Ancient Greek verb have also contributed significantly to the reconstruction of the Indo-European language since the early history of Linguistics in the nineteenth century. The conservative features preserved in the oldest stages of Greek allow us to rely on a solid basis to which every linguist must refer in investigating a model of …

etimologycognitive linguisticDistributed MorphologymorphologyAncient Greek verbal systemsemanticfunctional linguisticgrammatical categorietypological linguisticIndo-EuropeansyntaxpragmaticSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

Nazwy drzew w śląskiej toponimii

2015

The paper deals with geographical names in Silesia deriving from the names of tree species. An analysis of the names derived from appellatives, allows for a reconstruction of the categorization methods of the world, anthropological conceptualization, and a popular image of reality. Name creators choose names derived from the appellatives which are for certain reasons important and valuable for them, from the existing collection of names. For example, the following names of trees and shrubs become a productive toponymic base: oak, birch, alder; they belong to the basic categorization level and are important for the rural community due to their usable and practical significance (in constructi…

etnolingwistykaLinguistics and LanguagetoponymyRural communityConceptualizationmedia_common.quotation_subjectmotivational basekategoryzacjaToponymycultural onomasticsObject (philosophy)categorizationLanguage and LinguisticsLinguisticsGeographyCategorizationonomastyka kulturowaethnolinguisticsbaza motywacyjnaEthnolinguisticsFunction (engineering)toponimiaTree speciesmedia_commonOnomastica
researchProduct