Search results for "Fysiikka"

showing 10 items of 1348 documents

Colloquium: Nonequilibrium effects in superconductors with a spin-splitting field

2018

This Colloquium discusses the recent progress in understanding the properties of spin-split superconductors under nonequilibrium conditions. Recent experiments and theories demonstrate a rich variety of transport phenomena occurring in devices based on such materials that suggest direct applications in thermoelectricity, low-dissipative spintronics, radiation detection, and sensing. This text discusses different experimental situations and presents a theoretical framework based on quantum kinetic equations. This framework provides an accurate description of the nonequilibrium distribution of charge, spin, and energy, which are the relevant nonequilibrium modes, in different hybrid structure…

---General Physics and AstronomyLibrary scienceFOS: Physical sciences02 engineering and technologysuperconductors01 natural sciences7. Clean energysuprajohteetSuperconductivity (cond-mat.supr-con)Spin splitting0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)media_common.cataloged_instanceEuropean union010306 general physicskvanttifysiikkamedia_commonPhysicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter - SuperconductivityEuropean research021001 nanoscience & nanotechnologyquantum physicsCondensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

The effect of plasma instabilities on the background impurities in charge breeder ECRIS

2017

International audience; Experimental observations of plasma instabilities in the 14.5 GHz PHOENIX charge breeder ECRIS are summarized. It has been found that the injection of 133Cs+ or 85Rb+ into oxygen discharge of the CB-ECRIS can trigger electron cyclotron instabilities, which results to sputtering of the surfaces exposed to the plasma, followed by up to an order of magnitude increase of impurity currents in the extracted n+ charge state distribution. The transition from stable to unstable plasma regime is caused by gradual accumulation and ionization of Cs/Rb altering the discharge parameters in 10 - 100 ms time scale, not by a prompt interaction between the incident ion beam and the EC…

010302 applied physicsMaterials scienceIon beamta114syklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Buffer gasCyclotronPlasmaElectroncharge breederplasmafysiikka7. Clean energy01 natural sciences010305 fluids & plasmaslaw.inventionIonECRISSputteringlawIonization0103 physical sciencesAtomic physicsplasma (kaasut)plasma
researchProduct

Deviation of H− beam extraction simulation model

2018

Negative hydrogen ion source extraction system development is dependent on accurate and fast simulation methods for modelling the behaviour of ion and electron beams. Traditionally this type of work has been done using ray-tracing extraction codes, such as IBSimu. The plasma extraction model in IBSimu has been observed to under-estimate the charge density near the plasma sheath, leading to incorrect prediction of the current at which the system produces the optimum emittance. It is suspected that this deviation results from the approximations made by the model, neglecting the magnetic field and collisional effects near the sheath region. Results and comparisons to simulations are presented …

010302 applied physicsMaterials scienceta114business.industryExtraction (chemistry)tietokonegrafiikkaplasmafysiikka01 natural sciencesOpticsion sourcesPhysics::Plasma Physicscomputer graphics0103 physical sciencessimulointi010306 general physicsbusinessBeam (structure)plasma sheaths
researchProduct

Mechanisms of Electron-Induced Single-Event Upsets in Medical and Experimental Linacs

2018

In this paper, we perform an in-depth analysis of the single-event effects observed during testing at medical electron linacs and an experimental high-energy electron linac. For electron irradiations, the medical linacs are most commonly used due to their availability and flexibility. Whereas previous efforts were made to characterize the cross sections at higher energies, where the nuclear interaction cross section is higher, the focus of this paper is on the complete overview of relevant electron energies. Irradiations at an electron linac were made with two different devices, with a large difference in feature size. The irradiations at an experimental linac were performed with varying en…

010302 applied physicsNuclear and High Energy PhysicsMaterials scienceta114010308 nuclear & particles physicselectronsElectron linacElectronhiukkaskiihdyttimetelektronitparticle accelerators01 natural sciencesLinear particle acceleratorNuclear physicsNuclear interactionradiation physicsCross section (physics)säteilyfysiikkaNuclear Energy and Engineering0103 physical sciencesElectrical and Electronic EngineeringEvent (particle physics)IEEE Transactions on Nuclear Science
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Diagrammatic Expansion for Positive Spectral Functions in the Steady-State Limit

2019

Recently, a method was presented for constructing self-energies within many-body perturbation theory that are guaranteed to produce a positive spectral function for equilibrium systems, by representing the self-energy as a product of half-diagrams on the forward and backward branches of the Keldysh contour. We derive an alternative half-diagram representation that is based on products of retarded diagrams. Our approach extends the method to systems out of equilibrium. When a steady-state limit exists, we show that our approach yields a positive definite spectral function in the frequency domain.

010302 applied physicsSteady state (electronics)Statistical Mechanics (cond-mat.stat-mech)non-equilibrium Green's functionsFOS: Physical sciences02 engineering and technologyPositive-definite matrix021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsDiagrammatic reasoningspectral propertiesFrequency domainProduct (mathematics)0103 physical sciencesApplied mathematicsLimit (mathematics)Perturbation theory (quantum mechanics)0210 nano-technologyRepresentation (mathematics)kvanttifysiikkaCondensed Matter - Statistical MechanicsMathematicsperturbation theory
researchProduct

The biased disc of an electron cyclotron resonance ion source as a probe of instability-induced electron and ion losses

2019

International audience; Electron Cyclotron Resonance Ion Source (ECRIS) plasmas are prone to kinetic instabilities resulting in loss of electron and ion confinement. It is demonstrated that the biased disk of an ECRIS can be used as a probe to quantify such instability-induced electron and ion losses occurring in less than 10 µs. The qualitative interpretation of the data is supported by the measurement of the energy spread of the extracted ion beams implying a transient plasma potential >1.5 kV during the instability. A parametric study of the electron losses combined with electron tracking simulations allows for estimating the fraction of electrons expelled in each instability event to be…

010302 applied physics[PHYS]Physics [physics]Materials sciencesyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmahiukkaskiihdyttimetKinetic energyplasmafysiikka01 natural sciencesInstabilityElectron cyclotron resonanceIon source010305 fluids & plasmasIonPhysics::Plasma Physics0103 physical sciencesTransient (oscillation)Atomic physicsInstrumentation
researchProduct