Search results for "GASES"

showing 10 items of 1098 documents

Flat-band superconductivity in periodically strained graphene : mean-field and Berezinskii–Kosterlitz–Thouless transition

2020

In the search of high-temperature superconductivity one option is to focus on increasing the density of electronic states. Here we study both the normal and s-wave superconducting state properties of periodically strained graphene, which exhibits approximate flat bands with a high density of states, with the flatness tunable by the strain profile. We generalize earlier results regarding a one-dimensional harmonic strain to arbitrary periodic strain fields, and further extend the results by calculating the superfluid weight and the Berezinskii–Kosterlitz–Thouless (BKT) transition temperature T BKT to determine the true transition point. By numerically solving the self-consistency equation, w…

Condensed Matter::Quantum Gasesflat bandssuprajohtavuusnanorakenteetBCS theoryCondensed Matter::Superconductivitysuperconductivitygraphenestrain engineeringgrafeeni
researchProduct

"Table 1" of "Search for Supersymmetry in Events with Large Missing Transverse Momentum, Jets, and at Least One Tau Lepton in 7 TeV Proton-Proton Col…

2013

The observed number of signal events as a function of Lambda and Tan(Beta).

Condensed Matter::Quantum Gasesintegumentary systemHigh Energy Physics::Phenomenologytechnology industry and agricultureSUSY7000.0Jet ProductionP P --> TAU (TAU) (ELECTRON) (MUON) JETS MMProton-Proton ScatteringExclusiveHigh Energy Physics::ExperimentSupersymmetryTau productionskin and connective tissue diseaseshuman activities
researchProduct

"Table 9" of "Search for supersymmetry with jets, missing transverse momentum and at least one hadronically decaying $\tau$ lepton in proton-proton c…

2012

The total signal production cross section in the Lambda and tan(beta) plane in pb Note that bins with zero content in both Lambda abd Tan(Beta) have been omitted.

Condensed Matter::Quantum Gasesintegumentary systemProton-Proton ScatteringfungiHigh Energy Physics::Phenomenologytechnology industry and agricultureSUSYHigh Energy Physics::ExperimentSupersymmetryJet Productionskin and connective tissue diseaseshuman activities
researchProduct

Ion traps in nuclear physics : recent results and achievements

2016

Ion traps offer a way to determine nuclear binding energies through atomic mass measurements with a high accuracy and they are routinely used to provide isotopically or even isomerically pure beams of short-living ions for post-trap decay spectroscopy experiments. In this review, different ion-trapping techniques and progresses in recent nuclear physics experiments employing low-energy ion traps are discussed. The main focus in this review is on the benefit of recent high accuracy mass measurements to solve some key problems in physics related to nuclear structure, nuclear astrophysics as well as neutrinos. Also, several cases of decay spectroscopy experiments utilizing trap-purified ion sa…

Condensed Matter::Quantum GasesioniliikkuvuusspektrometriaAtomic mass measurementstrap-assisted spectroscopyastrofysiikkaNuclear binding energyhiukkasfysiikkaPhysics experimentsAtomic massNuclear astro-physicsPhysics::Atomic PhysicsDecay spectroscopiesydinfysiikkaMass measurementsIon traps
researchProduct

Mass Measurements of Proton-rich Nuclei with JYFLTRAP

2011

The Penning trap setup JYFLTRAP, connected to the IGISOL facility, has been extensively used for atomic mass measurements of exotic nuclei. On the proton rich side of the chart of nuclei mass measurements have mostly contributed to fundamental physics and nuclear astrophysics studies with about 100 atomic masses measured. peerReviewed

Condensed Matter::Quantum Gasesnuclear spectroscopyydinrakennenuclear physicsaccelerator-based physicsNuclear Theorynuclear structurePhysics::Atomic and Molecular ClustersydinspektroskopiaPhysics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Observation of a superfluid component within solid helium

2011

We demonstrate by neutron scattering that a localized superfluid component exists at high pressures within solid helium in aerogel. Its existence is deduced from the observation of two sharp phonon-roton spectra which are clearly distinguishable from modes in bulk superfluid helium. These roton excitations exhibit different roton gap parameters than the roton observed in the bulk fluid at freezing pressure. One of the roton modes disappears after annealing the samples. Comparison with theoretical calculations suggests that the model that reproduces the observed data best is that of superfluid double layers within the solid and at the helium-substrate interface. peerReviewed

Condensed Matter::Quantum Gasessupersolid 4HeCondensed Matter::OtherRestricted geometriesRajatut geometriatsupranestnosyys 4He kiteessäCondensed Matter::Mesoscopic Systems and Quantum Hall Effectsuprakide 4HeSuperfluidity in solid 4He
researchProduct

Skyrmion formation due to unconventional magnetic modes in anisotropic multiband superconductors

2019

Multiband superconductors have a sufficient number of degrees of freedom to allow topological excitations characterized by skyrmionic topological invariants. In the most common, clean s -wave multiband systems, the interband Josephson and magnetic couplings favor composite vortex solutions, without a skyrmionic topological charge. It was discussed recently that certain kinds of anisotropies lead to hybridization of the interband phase difference (Leggett) mode with magnetic modes, dramatically changing the hydromagnetostatics of the system. Here we report this effect for a range of parameters that substantially alter the nature of the topological excitations, leading to solutions characteri…

Condensed Matter::Quantum GasessuprajohtavuusCondensed Matter::Superconductivitymultiband superconductivityvortices in superconductorsCondensed Matter::Mesoscopic Systems and Quantum Hall Effectsuprajohteet
researchProduct

Effects of temperature on post-methanation of digested dairy cow manure in a farm-scale biogas production system.

2003

A post-methanation process that could be adopted at farm-scale, operating at temperatures prevailing in farm manure digester post-storage tanks, was evaluated. Digested manure samples from a farm digester (35 degrees C) and post-storage tank (5-10 degrees C) were incubated in parallel batches at 5-20 degrees C and as reference at 35 and 55 degrees C. Specific methane yields (kg(-1) volatile solids (VS)(added waste)) were 0.20-0.26 m3 at 35-55 degrees C and 0.085-0.09 m3 at 10-20 degrees C for digester material (345 days of incubation) and 0.16-0.21 m3 at 35-55 degrees C, 0.053-0.087 kg(-1) VS(added waste) m3 at 15-20 degrees C and 0.026 m3 at 10 degrees C for post-storage tank material (250…

Conservation of Natural ResourcesMethanechemistry.chemical_compoundBacteria AnaerobicAnimal scienceBioreactorsBiogasMethanationEnvironmental ChemistryAnimalsWaste Management and DisposalWater Science and TechnologyTemperatureGeneral MedicineManureRefuse DisposalManureWaste treatmentAnaerobic digestionDairyingchemistryAgronomyCattleGasesValorisationCow dungMethaneEnvironmental technology
researchProduct

Cold dark matter plus not-so-clumpy dark relics

2017

Various particle physics models suggest that, besides the (nearly) cold dark matter that accounts for current observations, additional but sub-dominant dark relics might exist. These could be warm, hot, or even contribute as dark radiation. We present here a comprehensive study of two-component dark matter scenarios, where the first component is assumed to be cold, and the second is a non-cold thermal relic. Considering the cases where the non-cold dark matter species could be either a fermion or a boson, we derive consistent upper limits on the non-cold dark relic energy density for a very large range of velocity dispersions, covering the entire range from dark radiation to cold dark matte…

Cosmology and Nongalactic Astrophysics (astro-ph.CO)Cold dark matterMilky WayCosmic microwave backgroundDark matterFOS: Physical sciencesAstrophysics::Cosmology and Extragalactic AstrophysicsAstrophysics7. Clean energy01 natural sciencessymbols.namesakeHigh Energy Physics - Phenomenology (hep-ph)0103 physical sciencesPlanck010303 astronomy & astrophysicsCondensed Matter::Quantum GasesPhysics010308 nuclear & particles physicsMatter power spectrumAstronomy and AstrophysicsBaryonHigh Energy Physics - Phenomenology13. Climate actionDark radiationsymbolsAstrophysics - Cosmology and Nongalactic Astrophysics
researchProduct

Gas measurements from the Costa Rica–Nicaragua volcanic segment suggest possible along-arc variations in volcanic gas chemistry

2014

Obtaining accurate estimates of the CO2 output from arc volcanism requires a precise understanding of the potential along-arc variations in volcanic gas chemistry, and ultimately of the magmatic gas signature of each individual arc segment. In an attempt to more fully constrain the magmatic gas signature of the Central America Volcanic Arc (CAVA), we present here the results of a volcanic gas survey performed during March and April 2013 at five degassing volcanoes within the Costa Rica-Nicaragua volcanic segment (CNVS). Observations of the volcanic gas plume made with a multicomponent gas analyzer system (Multi-GAS) have allowed characterization of the CO2/SO2-ratio signature of the plumes …

Costa RicaEarth scienceGeochemistryGas chemistryNicaraguaVolcanismArc (geometry)Volcanic GasesGeochemistry and Petrologyvolcanic gasesCO2 flux arc volcanism CAVA Costa Rica NicaraguaEarth and Planetary Sciences (miscellaneous)eventevent.disaster_typegeographygeography.geographical_feature_categoryVolcanic arcCAVAarc volcanismGas analyzerPlumeGeophysicsVolcanovolcanic gasesSpace and Planetary ScienceCO2 fluxGeologyEarth and Planetary Science Letters
researchProduct