Search results for "GSSP"

showing 10 items of 22 documents

Ontological representation of texts, and its applicationsin text analysis

2003

Masteroppgave i informasjons- og kommunikasjonsteknologi 2003 - Høgskolen i Agder, Grimstad For the management of a company, the need to know what people think of their products or services is becoming increasingly important in an increasingly competitive market. As the Internet can nearly be described as a digital mirror of events in the ”real“ world, being able to make sense of the semi structured nature of natural language texts published in this ubiquitous medium has received growing interest. The approach proposed in the thesis combines natural language processing and ontologies to represent elements in texts and relations between them. These relations are used to determine what terms …

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590Natural language processingOntologiesPositive/negative statementsVDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Algoritmer og beregnbarhetsteori: 422XMLContent free grammarsOWL
researchProduct

From Live Sequence Charts to implementation : a study of the LSC specification, the execution of behavioral requirements and exploring the possibilit…

2003

Masteroppgave i informasjons- og kommunikasjonsteknologi 2003 - Høgskolen i Agder, Grimstad In the article ”From Play-In Scenarios to Code: An Achievable Dream” [8] D.Harel outlines an exiting new way of developing software with the aid of the new and expressively powerful language of live sequence charts (LSC) [1] for describing message sequencing. The language of LSC is a highly visual approach for modeling behavioral requirements and is based on message sequence charts [13]. LSC introduces the ability to specify mandatory behavior in charts through the notion of “liveness”, events that must happen. The development process described involves using a friendly capture method called “play-in…

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Algoritmer og beregnbarhetsteori: 422VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Simulering visualisering signalbehandling og bildeanalyse: 429
researchProduct

Et studie i applikasjonsutvikling for ulike kommunikasjonsteknologier og UI på mobilterminaler

2004

Masteroppgave i informasjons- og kommunikasjonsteknologi 2004 - Høgskolen i Agder, Grimstad Den siste tiden er mobiltelefoners bruksområder blitt kraftig utvidet i form av støtte for tredjepartsprogramvare. SEA (Smart Energy Applications AS) har utviklet et trådløst styringssystem for smarthus basert på Bluetooth. I denne sammenhengen ønsker SEA å undersøke mulighetene for å benytte mobilterminaler til styring av Bluetooth nettverket. I denne oppgaven evalueres applikasjonsplattformer og kommunikasjonsteknologier, spesielt J2ME (Java 2 Micro Edition), Bluetooth og GPRS, med fokus på brukergrensesnitt. Videre diskuteres løsninger for trådløs styring av SEAs Bluetooth nettverk, for å avgjøre …

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Kommunikasjon og distribuerte systemer: 423
researchProduct

MDA and integration of legacy systems

2003

Masteroppgave i informasjons- og kommunikasjonsteknologi 2003 - Høgskolen i Agder, Grimstad OMG’s Model Driven ArchitectureTM, MDATM, is the new paradigm of software development and a new way of writing specifications and developing applications, based on a platform-independent model (PIM). MDA divorces implementation details from business functions. Thus, it is not necessary to repeat the process of modeling of applications or system’s functionality and behavior each time a new technology comes along. With the MDA, it is easier to integrate the new applications with the old application that is already installed. In the real time distributed telecommunication system, MDA addresses the chall…

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Kommunikasjon og distribuerte systemer: 423VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Systemutvikling og -arbeid: 426
researchProduct

Application development using J2ME : evaluation of intrinsic platform limitations

2005

Masteroppgave i informasjons- og kommunikasjonsteknologi 2005 - Høgskolen i Agder, Grimstad The operating system Symbian OS and the programming language Java have existed in a symbiosis since the first version of Symbian OS arrived on the mobile scene. This thesis will explore important aspects of the mobile version of Java, namely the Java 2 Micro Edition, on Symbian OS based mobile phones. Part one of the thesis reviews the structure and evolution of Java 2 Micro Edition and the Symbian OS, and the symbiosis between them. This is done through a thorough theoretical investigation of the programming interfaces offered to the developer. Particularly certain problem areas such as hardware con…

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Kommunikasjon og distribuerte systemer: 423VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Systemutvikling og -arbeid: 426
researchProduct

Application development using J2ME : architecture for device independence

2005

Masteroppgave i informasjons- og kommunikasjonsteknologi 2005 - Høgskolen i Agder, Grimstad The operating system Symbian OS and the programming language Java have existed in a symbiosis since the first version of Symbian OS arrived on the mobile scene. This thesis explores important aspects of the mobile version of Java, namely the Java 2 Micro Edition, on Symbian OS based mobile phones. Part one of the thesis reviews the structure and evolution of Java 2 Micro Edition and the Symbian OS, and the symbiosis between them. This is done through a thorough theoretical investigation of the programming interfaces offered to the developer. Particularly certain problem areas such as hardware control…

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Kommunikasjon og distribuerte systemer: 423VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Systemutvikling og -arbeid: 426
researchProduct

Using Ericsson NorARC's frameworks as test bed for dynamic change of behavior based on CompositeStates

2003

Masteroppgave i informasjons- og kommunikasjonsteknologi 2003 - Høgskolen i Agder, Grimstad Frameworks are a widely used re-use technique in the object-oriented community today. A framework re-uses both code and design and makes it easier to develop new components. Ericsson NorARC (Norwegian Applied Research Center) has developed a set of frameworks; JavaFrame, ActorFrame and ServiceFrame to aid advance service development. JavaFrame is a modeling kit for Java with good support for state machines. ActorFrame is a framework emphasizing the actor and role notion. ServiceFrame emphasize the modeling of service functionality. UML is today’s de facto standard for visualizing, specifying, constru…

VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Teoretisk databehandling programmeringsspråk og -teori: 421IKT590VDP::Matematikk og naturvitenskap: 400::Informasjons- og kommunikasjonsvitenskap: 420::Systemutvikling og -arbeid: 426
researchProduct

Döden i tidningsspråket

2004

dödenuutisetilmauksetsanomalehdetkuolematidningsspråketeufemismit
researchProduct

Finlandssvenska drag i dagens finlandssvenskt tidningsspråk

1998

finlandssvenskafinlandismfennicismtidningsspråk
researchProduct

Frekvenser av finlandismer i finlandssvenskt tidningsspråk

2016

Tutkielman tarkoituksena oli tutkia kuuden finlandismin ja kolmen verbin suomenruotsalaisien taivutusmuotojen yleisyyttä suomenruotsalaisissa lehdissä. Tutkimuksen materiaali on koostettu vuosilta 2012 ja 2013 kolmesta lehdestä: Hufvudstadsbladet, Vasabladet ja Åbo Underrättelser. Vertailin näiden lehtien tuloksia keskenään nähdäkseni, onko finlandismien käyttöasteessa eroja lehtien kesken. Tulokset osoittivat, että valitsemillani finlandismeilla on melko vähän esiintymiä kyseisissä lehdissä. Kolmesta verbistä, joiden taivutusmuotojen yleisyyttä tutkin, kahdella oli suomenruotsalaisissa muodoissa vähemmän esiintymiä kuin niiden tavallisilla taivutusmuodoilla, kun taas yhdellä kolmesta oli s…

finlandssvenskafinlandismfinlandssvenskt tidningsspråk
researchProduct