Search results for "Gene Expression"

showing 10 items of 4085 documents

Inhibition of small G proteins of the Rho family by statins orClostridium difficiletoxin B enhances cytokine-mediated induction of NO synthase II

2000

In order to investigate the involvement of Ras and/or Rho proteins in the induction of the inducible isoform of nitric oxide synthase (NOS II) we used HMG-CoA reductase inhibitors (statins) and Clostridium difficile toxin B (TcdB) as pharmacological tools. Statins indirectly inhibit small G proteins by preventing their essential farnesylation (Ras) and/or geranylgeranylation (Rho). In contrast, TcdB is a glucosyltransferase and inactivates Rho-proteins directly. Human A549/8- and DLD-1 cells as well as murine 3T3 fibroblasts were preincubated for 18 h with statins (1–100 μM) or TcdB (0.01–10 ng ml−1). Then NOS II expression was induced by cytokines. NOS II mRNA was measured after 4–8 h by R…

rho GTP-Binding ProteinsG proteinBacterial ToxinsMevalonic AcidNitric Oxide Synthase Type IISmall G ProteinClostridium difficile toxin BBiologyGene Expression Regulation EnzymologicMiceGeranylgeranylationBacterial ProteinsPolyisoprenyl PhosphatesPrenylationGTP-Binding ProteinsGene expressionAtorvastatinTumor Cells CulturedAnimalsHumansDrug InteractionsPyrrolesLovastatinPromoter Regions GeneticPharmacology3T3 CellsTransfectionMolecular biologyHeptanoic AcidsEnzyme InductionPapersCytokinesHydroxymethylglutaryl-CoA Reductase InhibitorsNitric Oxide SynthaseSignal transductionBritish Journal of Pharmacology
researchProduct

Lovastatin inhibits Rho-regulated expression of E-selectin by TNFalpha and attenuates tumor cell adhesion.

2003

E-selectin mediated cell-cell adhesion plays an important role in inflammatory processes and extravasation of tumor cells. Tumor necrosis factor-alpha (TNF-alpha) induces E-selectin gene and protein expression in primary human endothelial cells (HUVEC) and in an endothelial cell line (EA.hy-926). As shown by ELISA and FACS analyses, HMG-CoA reductase inhibitors (e.g., lovastatin) impair the TNF-alpha stimulated increase in E-selectin protein expression. Similar results were obtained for E-selectin mRNA expression and promoter activity, indicating that the effect of lovastatin is based on inhibition of gene expression. The effective inhibitory concentration of lovastatin was in a physiologic…

rho GTP-Binding ProteinsRHOATranscription GeneticRHOBAntineoplastic AgentsBiochemistryCell MovementCell Line TumorNeoplasmsGene expressionE-selectinGeneticsmedicineCell AdhesionHumansLovastatinCell adhesionMolecular BiologyCells CulturedbiologyTumor Necrosis Factor-alphaCell biologybiology.proteinCancer researchTumor necrosis factor alphaLovastatinEndothelium VascularSignal transductionE-SelectinBiotechnologymedicine.drugSignal TransductionFASEB journal : official publication of the Federation of American Societies for Experimental Biology
researchProduct

The Paracentrotus lividus metallothionein gene family: structure and expression.

2014

Metallothioneins are metal binding proteins that play a pivotal role in metal homeostasis and detoxification. Since their initial discovery, they have been extensively studied in a variety of organisms ranging from microbes to plants and animals. Organisms often possess multiple genes encoding metallothionein homologs with distinct properties, such as varying affinities for different metals, and in many cases different functions. Despite the plethora of available studies, very little information is known about sea urchin P. lividus MT (1, 2). We previously identified five Pl-MT embryonic cDNAs and we studied their induction after cadmium treatment (3). Now we studied their expression during…

sea urchin development metal response gene expressionSettore BIO/11 - Biologia Molecolare
researchProduct

Chromatin dynamics during sea urchin embryogenesis: effects on the neural alpha tubulin PlTa2 gene expression

2011

Expression of PlTa2 gene during sea urchin P. lividus development, is spatially confined to the neural territory and temporally activated from the blastula stage. To evaluate a possible involvement of chromatin modifications in regulation of PlTa2 gene expression we first searched for DNaseI hypersentive sites. We found four sites localized in the introns of the gene, when we used chromatin extracted from embryos at gastrula stage but not from morula stage. This result suggests a possible functional role of the introns in the activation of the expression of PlTa2 gene. Moreover, we used specific antibodies for RNA polymerase II and for different modified form of lysine 9, lysine 27 and lysi…

sea urchin gene expression chromatin tubulinSettore BIO/11 - Biologia Molecolare
researchProduct

Bcl-xL as a Modulator of Senescence and Aging

2021

Many features of aging result from the incapacity of cells to adapt to stress conditions. When cells are overwhelmed by stress, they can undergo senescence to avoid unrestricted growth of damaged cells. Recent findings have proven that cellular senescence is more than that. A specific grade of senescence promotes embryo development, tissue remodeling and wound healing. However, constant stresses and a weakening immune system can lead to senescence chronicity with aging. The accumulation of senescent cells is directly related to tissue dysfunction and age-related pathologies. Centenarians, the most aged individuals, should accumulate senescent cells and suffer from their deleterious effects,…

senescenceReviewmedicine.disease_causelcsh:Chemistry0302 clinical medicineImmunologic Surveillancelcsh:QH301-705.5SpectroscopyCellular Senescenceimmunosenescence0303 health sciencesapoptosisGeneral MedicineImmunosenescenceComputer Science ApplicationsCell biologyOrgan Specificity030220 oncology & carcinogenesisDisease SusceptibilitycentenariansProtein BindingSignal TransductionSenescencebcl-X ProteinBcl-xLBiologyCatalysisInorganic Chemistry03 medical and health sciencesImmune systemStress PhysiologicalmedicineAnimalsHumansPhysical and Theoretical ChemistrySenolyticMolecular Biology030304 developmental biologyBcl-xLOrganic ChemistryIntrinsic apoptosisagingGene Expression Regulationlcsh:Biology (General)lcsh:QD1-999senolyticsbiology.proteinWound healingOxidative stressBiomarkersDNA DamageInternational Journal of Molecular Sciences
researchProduct

Maturation of Epidermal Langerhans Cells In Vitro Is Accompanied by Downregulation of 4F2 (CD98) as Determined by Differential Display

1998

Following short-term culture, Langerhans cells mature morphologically and functionally into potent immunostimulatory cells. As regulation of gene expression accompanies this maturation process, it is likely that differentially expressed genes are involved in the maturation events. Using the recently described method of differential display, we generated cDNA expression patterns starting with mRNA of murine epidermal Langerhans cells isolated either directly (fLC) or following 3 d cultivation (cLC). Five hundred putative differentially expressed cDNA fragments were recovered from the gel. For a part of the fragments differential expression was confirmed by dot blot and Southern hybridization…

skinLangerhans cellDNA ComplementaryDown-RegulationFusion Regulatory Protein-1GrowthDermatologyBiologyBiochemistryMiceDownregulation and upregulationAntigens CDComplementary DNAmedicineAnimalsRNA MessengerCloning Moleculardifferential gene expressionGeneMolecular BiologySouthern blotRegulation of gene expressionJNK2Differential displayMice Inbred BALB Cepidermal cellsGene Expression Regulation DevelopmentalCell BiologyMolecular biologyMice Inbred C57BLmedicine.anatomical_structureGenesCell cultureLangerhans CellsAntigens SurfaceCarrier ProteinsSequence AnalysisJournal of Investigative Dermatology
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Comparative transcriptomics of albino and warningly‐coloured caterpillars

2021

Abstract Coloration is perhaps one of the most prominent adaptations for survival and reproduction of many taxa. Coloration is of particular importance for aposematic species, which rely on their coloring and patterning acting as a warning signal to deter predators. Most research has focused on the evolution of warning coloration by natural selection. However, little information is available for color mutants of aposematic species, particularly at the genomic level. Here, I compare the transcriptomes of albino mutant caterpillars of the aposematic wood tiger moth (Arctia plantaginis) to those of their full sibs having their distinctive orange‐black warning coloration. The results showed >29…

suojautuminenvaroitusväri0106 biological sciencesZoologyContext (language use)Aposematismmelaniinit010603 evolutionary biology01 natural sciencesPredationMelanin03 medical and health sciencesmedicineaposematismgeeniekspressioArctia plantaginisCaterpillarGeneQH540-549.5Ecology Evolution Behavior and SystematicsOriginal Research030304 developmental biologyNature and Landscape Conservation0303 health sciencesgeenitNatural selectionEcologybiologyfungimedicine.diseasebiology.organism_classificationmelaninalbinismigene expressionAlbinismEcology and Evolution
researchProduct

Response to the Letter to the editor regarding “Targeting NUPR1 with the small compound ZZW-115 is an efficient strategy to treat hepatocellular carc…

2021

therapyCancer ResearchCarcinoma HepatocellularLetter to the editorbusiness.industryLiver Neoplasmshepatocellular carcinomamedicine.diseaseNeoplasm ProteinsGene Expression Regulation NeoplasticOncologyHepatocellular carcinomaCancer researchHumansMedicineStress ProteinsbusinessCancer Letters
researchProduct