Search results for "Gill"

showing 10 items of 496 documents

Elizabeth Grosz, sukupuolen filosofia ja erojen tulevaisuus

2005

feministinen teoriaGrosz ElizabethsukupuolierotDeleuze GillesIrigaray Lucesukupuoli
researchProduct

Ontologia e verità nella filosofia di Gilles Deleuze

2011

filosofia di Gilles Deleuze.Ontologia e veritàSettore M-FIL/01 - Filosofia Teoretica
researchProduct

Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

2020

 Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

filosofitkapitalismimetafysiikkatietotekniikkainformaatiokoneetkulttuurifilosofiayhteiskuntafilosofialuovuusteknologiaDeleuze GillessynteesiLektiotGuattari FélixmateriaalisuusAjatus
researchProduct

Cytotoxicity of 91 Kenyan indigenous medicinal plants towards human CCRF-CEM leukemia cells.

2015

Abstract Ethnopharmacological relevance Plants from Kenyan flora are traditionally used against many ailments, including cancer and related diseases. Cancer is characterized as a condition with complex signs and symptoms. Recently there are recommendations that ethnopharmacological usages such as immune and skin disorders, inflammatory, infectious, parasitic and viral diseases should be taken into account when selecting plants that treat cancer. Aim The present study was aimed at investigating the cytotoxicity of a plethora of 145 plant parts from 91 medicinal plants, most of which are used in the management of cancer and related diseases by different communities in Kenya, against CCRF-CEM …

food.ingredientCell Survival01 natural sciences03 medical and health sciences0302 clinical medicinefoodCell Line TumorDrug DiscoveryHumansMedicinal plantsCytotoxicityPharmacologyLeukemiaPlants MedicinalbiologyTraditional medicinePlant ExtractsZanthoxylum gilletiiSolanum aculeastrumBridelia micranthabiology.organism_classificationAntineoplastic Agents PhytogenicKenyaGrowth Inhibitors0104 chemical sciences010404 medicinal & biomolecular chemistry030220 oncology & carcinogenesisHerbvisual_artvisual_art.visual_art_mediumBarkErythrina sacleuxiiJournal of ethnopharmacology
researchProduct

Induction of new metabolites from sponge-associated fungus Aspergillus carneus by OSMAC approach.

2018

Abstract A comparative study on the metabolic profile of the sponge-associated fungus Aspergillus carneus using the OSMAC approach was conducted. The fungal strain was fermented on three different media including solid rice medium with or without sea salt and modified Czapek medium. Three new natural products, isopropylchaetominine (1), isoterrelumamide A (2) and 5′-epi-averufanin (3), together with fourteen known compounds (4–17) were isolated. The structures of the new compounds were established by 1D and 2D NMR spectroscopic analysis as well as by HRESIMS. Compound 2 was only found when the fungus was cultivated on modified Czapek medium, whereas compounds 4, 7, 11, 12, and 14 were only …

food.ingredientMagnetic Resonance SpectroscopyAntineoplastic AgentsFungus010402 general chemistry01 natural sciencesMicefoodCell Line TumorDrug DiscoveryAnimalsFood scienceCytotoxicityPharmacologyBiological ProductsbiologyMolecular Structure010405 organic chemistryChemistrySea saltGeneral Medicinebiology.organism_classificationAntimicrobial0104 chemical sciencesAnti-Bacterial AgentsPoriferaSpongeAspergillusCell cultureMetabolomeFermentationAntibacterial activityFitoterapia
researchProduct

Non-Botrytis grape-rotting fungi responsible for earthy and moldy off-flavors and mycotoxins

2012

Abstract The grape microflora is complex and includes filamentous fungi, yeasts and bacteria with different physiological characteristics and effects on wine production. Most studies have focused on the wine microbiota, but a few studies have reported the ecology of grape microorganisms. Some of these organisms — such as non-Botrytis bunch rotting fungi, which greatly influence the safety or sensory quality of wine, due to the production of mycotoxins and off-flavors, respectively — are considered to be spoilage agents. We review here the diversity of filamentous fungi on grapes and the factors influencing their development, such as grape ripening stage, environmental factors (climate, rain…

food.ingredientMicroorganismPopulationFood spoilageWineMicrobiologychemistry.chemical_compoundfoodBotanyHumansVitisFood scienceeducationMycotoxinBotrytisWineeducation.field_of_studyAspergillusbiologyfungiFungifood and beveragesMycotoxinsbiology.organism_classificationchemistryTasteFermentationPenicilliumFood ScienceFood Microbiology
researchProduct

Tecniche esecutive e controllo di qualità dei lavori in terra-calce

2010

Sebbene si tratti di una tecnica largamente sperimentata da diversi anni, ormai, e sviluppata per impieghi differenti che vanno dalla realizzazione di rilevati (stradali, ferroviari ed aeroportuali) alla formazione di strati di sottofondazione ed anche di fondazione delle pavimentazioni, la stabilizzazione con calce (o con calce e cemento), per essere applicata secondo le attuali regole dell’arte, richiede: · conoscenze tecniche comprovate negli studi di progetto delle miscele e nell’adeguamento della composizione delle stesse, in corso d’opera, in relazione alla variabilità dei fattori di cantiere (contenuto naturale d’acqua dei terreni, condizioni climatiche, dispersioni di dosaggio); · m…

geotecnica stradale e ferroviaria stabilizzazione a calce argille rilevati e sottofondiSettore ICAR/04 - Strade Ferrovie Ed Aeroporti
researchProduct

Lignin and Cellulose Content of Fermented Rice Straw with Aspergillus niger (van Tieghem) and Trichoderma mutan AA1

2021

The rice straw has potential to be used as an alternative ruminant feed. However, it has limiting factors i.e low crude protein, high crude fiber, lignin, cellulose, and silica content. To overcome the limiting factors, immersion in a solution of alkaline (lime) or fermentation by using inoculum microbial cellulolytic and lignocellulolytic (Trichoderma mutan AA1 and Aspergillus niger.). The research method was experimental, with four treatments and repeated five times. Completely randomized design was used and if there are differences among treatments a further test with DMRT was carried out (level 1 % and 5 %). These treatments were T0: The rice straw without t fermentation; T1: Fermented …

increase feed quality020209 energy02 engineering and technologyengineering.material01 natural scienceschemistry.chemical_compoundRuminant0103 physical sciences0202 electrical engineering electronic engineering information engineeringLigninFood scienceCellulosefermentationCompletely randomized designlcsh:Environmental sciencesLimelcsh:GE1-350biology010308 nuclear & particles physicsChemistryAspergillus nigerfungusfood and beveragesbiology.organism_classificationTrichodermaengineeringFermentationwaste to feedinoculumE3S Web of Conferences
researchProduct

Synthesis, characterization and antimicrobial activity of palladium(II) complexes with some alkyl derivates of thiosalicylic acids: Crystal structure…

2012

Abstract S-Alkyl (R = benzyl, methyl, ethyl, propyl and butyl) derivatives of thiosalicylic acid and the corresponding palladium(II) complexes were prepared and their structures were proposed on the basis of infrared, 1H and 13C NMR spectroscopy. The cis geometrical configurations of the isolated complexes were proposed on the basis of an X-ray structural study of the bis(S-benzyl-thiosalicylate)–palladium(II), [Pd(S-bz-thiosal)2] complex. Antimicrobial activity of the tested compounds was evaluated by determining the minimum inhibitory concentration (MIC) and minimum microbicidal concentration (MMC) in relation to 26 species of microorganisms. The tested ligands, with a few exceptions, sho…

inorganic chemicalschemistry.chemical_classificationThiosalicylic acidbiologyStereochemistrychemistry.chemical_elementCrystal structurebiology.organism_classificationAntimicrobialMedicinal chemistryAspergillus fumigatusInorganic Chemistrychemistry.chemical_compoundMinimum inhibitory concentrationchemistryMaterials ChemistryPhysical and Theoretical ChemistryAntibacterial activityta116AlkylPalladiumPolyhedron
researchProduct

Arvio: Tony Gillam (2018) Creativity, Wellbeing and Mental Health Practice, Palgrave Macmillian, ISBN 978-3-319-74884-9 (eBook)

2018

kirja-arvostelutmielenterveyshyvinvointikirjailijatluovuusGillam Tony
researchProduct