Search results for "Green"

showing 10 items of 1660 documents

Competitive Pressure and Diversification into Green R&D

2019

Based on representative firm-level survey data for Austria, Germany, and Switzerland, we investigate the relationship between quick obsolescence of products, unpredictable technological development, and easy substitution of products and the probability to diversify into green R&D. We find that product obsolescence and technological uncertainty are positively related with green R&D diversification. These types of competition are usually positively related with low barriers to market entry. Hence, policies that support open markets should stimulate diversification into green R&D. peerReviewed

kilpailu (talous)competitive pressuremarket entrygreen R&Dtutkimus- ja kehittämistoimintauutuudetvihreä taloustuotekehitysproduct market competition
researchProduct

Synkähköä fantasiaa nuorille

2019

Kirja-arvostelu teoksesta Sally Green. Savuvarkaat, Gummerus 2019, suom. Sari Kumpulainen. nonPeerReviewed

kirja-arvostelutnuortenkirjallisuusfantasiakirjallisuusSavuvarkaatGreen Sally
researchProduct

Rapid Quantification of Microalgae Growth with Hyperspectral Camera and Vegetation Indices

2021

Spectral cameras are traditionally used in remote sensing of microalgae, but increasingly also in laboratory-scale applications, to study and monitor algae biomass in cultures. Practical and cost-efficient protocols for collecting and analyzing hyperspectral data are currently needed. The purpose of this study was to test a commercial, easy-to-use hyperspectral camera to monitor the growth of different algae strains in liquid samples. Indices calculated from wavebands from transmission imaging were compared against algae abundance and wet biomass obtained from an electronic cell counter, chlorophyll a concentration, and chlorophyll fluorescence. A ratio of selected wavebands containing near…

klorofylligrowthmonitorointilevätympäristön tilaremote sensingstrainvegetationviherlevätmobile spectral camerachlorophyllstate of the environmentbiomassa (ekologia)algaerasitusbiomassmicroalgaespektrikuvausfluoresenssiBotanykasvillisuusmikrolevätgreen algaemonitoringtransmission imagingvegetation indicesQK1-989kaukokartoitusPlants
researchProduct

Developments in many-body theory of quantum transport and spectroscopy with non-equilibrium Green's functions and time-dependent density functional t…

2015

The problem of quantum dynamics in open systems has gained attention in recent decades and not the least due to the advances made in quantum transport in molecular systems. The main motivation behind quantum transport and molecular electronics is the futuristic goal to be able at some point to replace, or to complement, the silicon-based technology and to make the electronic devices faster. On a fundamental level, one has to deal with time-dependent processes where electron-electron or electron- phonon interactions are of great importance, and they can cause profound quantitative and qualitative changes on the physical and dynamical properties of electronic systems compared to the non-inter…

kvanttikuljetuselektronikorrelaationanoelektroniikkatiheysfunktionaaliteoriamonen kappaleen häiriöteoriaGreenin funktiokvanttikemiakvanttimekaniikkakvanttifysiikkamolekyylielektroniikkaelektronittiheysmatriisirenormalisaatioryhmädynamiikka
researchProduct

Localization of GFP-Tagged Proteins at the Electron Microscope

2016

lawCryo-electron microscopyChemistryBiophysicsElectron microscopelaw.inventionGreen fluorescent protein
researchProduct

Model research on the influence of green roofs on environmental parameters in urban agglomerations

2018

The intensive development of urban agglomerations in Poland and other European countries has rendered the growth of biologically active areas more important with respect the quality of the urban environment. Taking the rapidly rising prices of plots in city centers into consideration, it is worth noting the vast surfaces of building roofs that can be used as biologically active areas. The term green roof is to be understood as an open, overgrown surface on a multilayer roof of a building. Green roofs can only be made on a planar surface with an inclination of 2% to 30%. In accordance with the type of usage, construction factors and maintenance requirements, green roofs are typically defined…

lcsh:GE1-350Pollutantgreen roofUrban agglomerationbusiness.industryurban areasair pollutionGreen roofrainwater0211 other engineering and technologiesEnvironmental engineering02 engineering and technology010501 environmental sciencesParticulates01 natural sciencesRainwater harvestingThermal insulationEnvironmental science021108 energyheavy metalsbusinessSurface runoffRooflcsh:Environmental sciences0105 earth and related environmental sciencesE3S Web of Conferences
researchProduct

Methodology for Calculating the Potential Maritime Wind Park Area by Taking into Account the Needs of Shipping Sector

2018

Renewable energy sources (wind energy, solar energy, hydroelectricity, ocean energy, geothermal energy, biomass and biofuels) are alternatives to fossil fuel that help to reduce greenhouse gas emissions, diversify energy supplies and reduce dependency on markets of unsustainable and volatile fossil fuels, particularly oil and gas. Wind energy is one of the renewable energy sources and is considered to be self-renewable as it is the result of the Sun’s activity. Using wind energy is a rapidly developing industry today, and more and more wind turbines are installed worldwide every year, land-based wind turbines being more widespread than offshore ones. In Latvia, spread of land-based wind par…

lcsh:GE1-350Wind powerNatural resource economicsbusiness.industryGeothermal energyFossil fuelRenewable energyOffshore wind powerHydroelectricityGreenhouse gasMarine energyEnvironmental sciencebusinesslcsh:Environmental sciencesE3S Web of Conferences
researchProduct

Accounting Changes on Green Certificates in Romania

2017

The purpose of green certificates is to get more renewable electric energy into the energy market at the expense of traditional energy, which in most countries is based on fossil fuel. These renewable technologies are too expensive to enter the market on commercial terms. A key feature of the scheme is that producers of energy based on new renewable energy sources receive certificates from the authorities, proportional to their output. The users of electric energy are required to buy a certain amount of these certificates when they buy electricity. Green certificates may in principle contribute to a reduction of the production of traditional energy.

lcsh:HB71-74green certificatesaccountinglcsh:Economics as a sciencelcsh:Businesslcsh:HF5001-6182renewable energyOvidius University Annals: Economic Sciences Series
researchProduct

Enhancing a Transition to a Circular Economy in the Water Sector: The EU Project WIDER UPTAKE

2021

A novel approach for resource recovery includes forward osmosis (FO) as a concentration step in municipal wastewater treatment. The current study investigates different pre-treatment strategies including biological treatment with a moving-bed bioreactor (MBBR) at different loading rates and particle removal by filtration and sedimentation. Membrane performance and recovery potential for energy and nutrients were investigated in laboratory-scale FO experiments in batch mode using pre-treated municipal wastewater as feed and 35 g/L NaCl as a draw solution. Initial water fluxes were in the range of 6.3 to 8.0 L/(m2·h). The baseline fluxes were modelled to account for flux decline due to concen…

lcsh:Hydraulic engineeringtutela e gestione delle acqueGeography Planning and DevelopmentWastewater treatment02 engineering and technology010501 environmental sciencesReusenudge theory01 natural sciencesBiochemistry:Teknologi: 500 [VDP]lcsh:Water supply for domestic and industrial purposesSettore IUS/05 - Diritto Dell'Economia0202 electrical engineering electronic engineering information engineeringWater Science and TechnologyResource recoverymedia_commonCircular economysustainabilityNatural resource6. Clean waterwastewater treatmentSewage treatmentbehavioural law and economiceuropean environmental lawCircular economysmart waterProcess (engineering)sludge reuse020209 energySmart waterContext (language use)Aquatic Science12. Responsible consumptiongreen economydisciplina delle acque reflue e dei fanghilcsh:TC1-978Settore IUS/01 - Diritto Privatomedia_common.cataloged_instanceEuropean union0105 earth and related environmental sciencesdiritto dell'ambientenew green deallcsh:TD201-500Settore ICAR/03 - Ingegneria Sanitaria-Ambientalecircular economyEnvironmental economicsenvironment protectionwaste managementBusiness
researchProduct

The effect of residential urban greenness on allergic respiratory diseases in youth: A narrative review

2020

Abstract Background Environmental exposures across the life course may be a contributor to the increased worldwide prevalence of respiratory and allergic diseases occurring in the last decades. Asthma and rhinoconjunctivitis especially contribute to the global burden of disease. Greenness has been suggested to have beneficial effects in terms of reduction of occurrence of allergic respiratory diseases. However, the available evidence of a relationship between urban greenness and childhood health outcomes is not yet conclusive. The current review aimed at investigating the current state of evidence, exploring the relationship between children's exposure to residential urban greenness and dev…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory Medicineallergic respiratory diseasesgreennessImmunologyPopulationMEDLINEreviewArticleAllergic sensitization03 medical and health sciences0302 clinical medicineEnvironmental health11. SustainabilityImmunology and AllergyMedicine030223 otorhinolaryngologyeducationExposure assessmentAsthmayoutheducation.field_of_studybusiness.industryrhinoconjunctivitislung functionasthmamedicine.disease3. Good healthgreenness asthma rhinoconjunctivitis lung function youth030228 respiratory systemBronchitisLife course approachNarrative reviewlcsh:RC581-607business
researchProduct