Search results for "HDI"

showing 10 items of 789 documents

Candida antarctica Lipase A-Based Enantiorecognition of a Highly Strained 4-Dibenzocyclooctynol (DIBO) Used for PET Imaging

2020

The enantiomers of aromatic 4-dibenzocyclooctynol (DIBO), used for radiolabeling and subsequent conjugation of biomolecules to form radioligands for positron emission tomography (PET), were separated by kinetic resolution using lipase A from Candida antarctica (CAL-A). In optimized conditions, (R)-DIBO [(R)-1, ee 95%] and its acetylated (S)-ester [(S)-2, ee 96%] were isolated. In silico docking results explained the ability of CAL-A to differentiate the enantiomers of DIBO and to accommodate various acyl donors. Anhydrous MgCl2 was used for binding water from the reaction medium and, thus, for obtaining higher conversion by preventing hydrolysis of the product (S)-2 into the starting materi…

entsyymitaromaattiset yhdisteetbiocatalysisStereochemistryPharmaceutical Sciencemerkkiaineet010402 general chemistry01 natural sciencesArticleAnalytical ChemistryKinetic resolutionlcsh:QD241-441lcsh:Organic chemistryAcyl bindinglipaasitDrug DiscoveryHydrolasekinetic resolutionPhysical and Theoretical ChemistryLipaseBinding sitebiology010405 organic chemistryChemistrymolecular modelingOrganic ChemistryActive sitebiokatalyysiDIBOlipase A from Candida antarcticabiology.organism_classificationlaskennallinen kemialuonnonaineet0104 chemical scienceshiivasienetChemistry (miscellaneous)lipase a from <i>candida antarctica</i>biology.proteinMolecular MedicineCandida antarcticaEnantiomerMolecules
researchProduct

Reflections of Hope and Anxiety in Audience Responses to Three Environmental Films

2023

This article discusses the results of a reception study of three environmental films with a focus on emotional reactions and the films’ influence on the respondents’ environmental awareness. The short experimental film Valtakunnat/Realms (Finland, 2018) envisions post-human life, and the potential destruction that the planet is being driven towards. To Teach a Bird to Fly (Finland, 2020), a short documentary fiction film about a woman raising critically endangered birds, imagines a future where the effects of climate change have been reversed. The documentary film The Biggest Little Farm (USA, 2018) follows a couple who buy a barren farm with the aim of restoring its biodiversity. Through t…

environmental filmekokatastrofitekokritiikkireception studyRealmsempirical ecocriticismelokuvatTo Teach a Bird to FlyympäristökysymyksetdystopiattunteetThe Biggest Little Farmreseptioahdistustoivoutopiatympäristötietoisuus
researchProduct

Molybdenum(VI) complexes with a chiral L-alanine bisphenol [O,N,O,O’] ligand : Synthesis, structure, spectroscopic properties and catalytic activity

2023

Dioxidomolybdenum(VI) compound [MoO2Cl2(dmso)2] reacts with a chiral tetradentate O3N-type L-alanine bisphenol ligand precursor (Et3NH)H2Lala to form an oxidochloridomolybdenum(VI) complex [MoOCl(Lala)] (1) as two separable geometric isomers with phenolate groups in cis or trans positions. The single crystal X-ray and NMR analyses of cis- and trans-1 reveal that the complexes are formed of monomeric molecules, in which the ligand has a tetradentate coordination through three oxygen donors and one nitrogen donor. The reaction of Na2MoO4·2H2O with the same ligand precursor in an acidic methanol solution leads to the formation of an anionic dioxido complex (Et3NH)[MoO2(Lala)] (2) with a trans …

epoxidationsmolybdenumkatalyytitcatalysisL-alaninekompleksiyhdisteetmolybdeeni
researchProduct

Orgaaniset ja metallo-orgaaniset epälineaariset optiset materiaalit

2017

Tässä tutkielmassa on perehdytty kirjallisuudessa raportoituihin orgaanisiin ja metallo-orgaanisiin epälineaarisiin optisiin (NLO) materiaaleihin sekä tutkittu mahdollisuutta valmistaa niitä yksinkertaisista orgaanisista molekyyleistä. Työn kirjallisessa osassa luodaan lyhyt katsaus NLO-teoriaan sekä käydään läpi orgaanisten ja metallo-orgaanisten NLO-yhdisteiden lisäksi erilaisia toisen harmonisen säteilyn (SHG) mittaustekniikoita sekä erilaisia kiteytystekniikoita. Kokeellisessa osuudessa on valmistettu polaarisista molekyyleistä heikoilla vuorovaikutuksilla sitoutuneita yhdisteitä, joista osalla on havaittu olevan SHG-ominaisuuksia.

epälineaariset optiset materiaalitorganometalliyhdisteetNLO
researchProduct

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

Työn eetos, vapaus, onnellisuus : perheyrittäjien arvojen kuvauksen rakentuminen eräiden suomalaisten lehtien reportaaseissa

2014

family entrepreneuryrittäjätyrittäjyystyödiskurssianalyysitekstintutkimuslehdistökirjoitteluworknew reportfamily enterprisereportaasitvalueshappinessfreedomsanomalehdetarvotonnellisuusaikakauslehdetvapausperheyrityksetmenestyminen
researchProduct

Diary of an anxious soul and how pole dancing saved me : an autoethnography

2017

Þórhallsdóttir, Sveindís. (2017). Diary of an anxious soul and how pole dancing saved me: An autoethnography. Master’s thesis in sport and exercise psychology. Faculty of Sport Sciences. University of Jyväskylä. 150p. In this thesis, I use narrative reflection from an evocative autoethnographic standpoint to explore the multifaceted interaction between stereotypes, norms and values and their effect on my perception of my own worth, my battle with generalized anxiety disorder and with my cognitive dissonance fused frustration related to discovering and enjoying a highly stigmatized recreational activity – recreational pole dancing. The text features analysis of important events in my life in…

feminismrecreational pole dancingfeminismiAutoetnografiatankotanssiahdistuneisuushäiriötAutoethnographyevocativeimpostor phenomenonyleistynyt ahdistuneisuushäiriögeneralized anxiety disorder
researchProduct

Oxidovanadium(v) complexes with l-proline-based amino acid phenolates

2019

Abstract l -proline was used to prepare chiral, tridentate amino acid phenol proligands H2L1–4. These proligands react with vanadium precursors VO(acac)2, VOSO4∙5H2O and VO(OPr)3 in methanol to form the corresponding oxidoalkoxidovanadium( v ) complexes 1–4. The complexes crystallize from methanol, and are octahedrally coordinated with a general formula [VO(L1–4)(OMe)(MeOH)]. In solution, however, they adopt several different conformations or isomeric structures depending on the solvent.

fenolitVanadiumchemistry.chemical_elementphenolsaminohapot010402 general chemistry01 natural sciencesMedicinal chemistryvanadiiniInorganic Chemistrychemistry.chemical_compoundMaterials ChemistryPhenolcoordination complexesProlinePhysical and Theoretical Chemistryta216ta116chemistry.chemical_classificationamino acids010405 organic chemistrykompleksiyhdisteet0104 chemical sciencesAmino acidSolventchemistryvanadiumMethanolInorganica Chimica Acta
researchProduct

The Machiavellian reformation : an essay in political theory

2006

Uskonnon asema Niccolò Machiavellin (1469–1527) politiikan teoriassa on herättänyt laajaa keskustelua. Toisten mukaan Machiavelli oli harras katolilainen ja huolestunut siitä, että poliittisessa toiminnassa ei voi seurata kristillisiä ohjeita. Toisaalta on väitetty, että Machiavelli oli ateisti, jonka tarkoituksena oli erottaa politiikka ja moraali toisistaan ja hävittää uskonto kokonaan. Useimmiten Machiavelli nähdään uuspakanallisuuden kannattajana, sillä hän ihaili antiikin Roomaa ja sen uskonnollisia käytäntöjä.Machiavellin ”reformaatiota” väitöstyössään tutkinut Paul-Erik Korvela esittää, että kaikki nämä näkemykset ovat harhaanjohtavia.Renessanssin aikainen kirkko ja erityisesti sen y…

filosofitmachiavellismirenessanssiuskonpuhdistususkontokritiikkiMachiavelli Niccolòpoliittinen filosofiapolitiikan teoriakristinusko
researchProduct

Efficient stabilisation of a dihydrogenphosphate tetramer and a dihydrogenpyrophosphate dimer by a cyclic pseudopeptide containing 1,4-disubstituted …

2017

A cyclic pseudooctapeptide 2 is described containing 1,4-disubstituted 1,2,3-triazole moieties. This compound features eight converging hydrogen bond donors along the ring, namely four amide NH and four triazole CH groups, which enable 2 to engage in interactions with anions. While fully deprotonated sulfate anions exhibit only moderate affinity for 2, protonated anions such as dihydrogenpyrophosphate and dihydrogenphosphate anions are strongly bound. Complexation of the phosphate-derived anions involves sandwiching of a dihydrogenpyrophosphate dimer or a dihydrogenphosphate tetramer between two pseudopeptide rings. X-ray crystallography provided structural information, while 1H NMR spectro…

fosfaatit010405 organic chemistryStereochemistryChemistryHydrogen bondDimerTriazoleIsothermal titration calorimetryProtonationGeneral Chemistry010402 general chemistry01 natural sciencesphosphate oligomers0104 chemical sciencesoligomeeriCrystallographychemistry.chemical_compoundDeprotonationpseudopeptidesTetramerAmidestabilisationta116orgaaniset yhdisteetChemical Science
researchProduct