Search results for "IKK"

showing 10 items of 10819 documents

Are we who we cite? : on epistemological injustices, citing practices, and #metoo in academia

2019

The #metoo movement reaching academia and Applied Linguistics creates a need for discussion on how we as scholars react to oppressive ideologies and behaviors in our community. However, this is not merely a question of processing cases of sexual harassment and assault. More deeply, we need conversations on who we do and do not know, read, and cite, and how to make our field more epistemologically equitable. This article hopes to elicit comments, reactions, and dialogue. nonPeerReviewed

#metootietoteoriaviitteetepistemological (in)justiceyhteiskunnalliset liikkeetciting practices
researchProduct

Colloquium: Nonequilibrium effects in superconductors with a spin-splitting field

2018

This Colloquium discusses the recent progress in understanding the properties of spin-split superconductors under nonequilibrium conditions. Recent experiments and theories demonstrate a rich variety of transport phenomena occurring in devices based on such materials that suggest direct applications in thermoelectricity, low-dissipative spintronics, radiation detection, and sensing. This text discusses different experimental situations and presents a theoretical framework based on quantum kinetic equations. This framework provides an accurate description of the nonequilibrium distribution of charge, spin, and energy, which are the relevant nonequilibrium modes, in different hybrid structure…

---General Physics and AstronomyLibrary scienceFOS: Physical sciences02 engineering and technologysuperconductors01 natural sciences7. Clean energysuprajohteetSuperconductivity (cond-mat.supr-con)Spin splitting0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)media_common.cataloged_instanceEuropean union010306 general physicskvanttifysiikkamedia_commonPhysicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter - SuperconductivityEuropean research021001 nanoscience & nanotechnologyquantum physicsCondensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct

Coexistence of superconductivity and spin-splitting fields in superconductor/ferromagnetic insulator bilayers of arbitrary thickness

2021

Ferromagnetic insulators (FI) can induce a strong exchange field in an adjacent superconductor (S) via the magnetic proximity effect. This manifests as spin splitting of the BCS density of states of the superconductor, an important ingredient for numerous superconducting spintronics applications and the realization of Majorana fermions. A crucial parameter that determines the magnitude of the induced spin splitting in FI/S bilayers is the thickness of the S layer d: In very thin samples, the superconductivity is suppressed by the strong magnetism. By contrast, in very thick samples, the spin splitting is absent at distances away from the interface. In this work, we calculate the density of …

---suprajohtavuusnanoelektroniikkaCondensed Matter - SuperconductivityEuropean researchOdd Triplet SuperconductivityFOS: Physical sciencesequation02 engineering and technologyPublic administration021001 nanoscience & nanotechnology01 natural sciences3. Good healthsuprajohteetSuperconductivity (cond-mat.supr-con)Spin splittingPolitical scienceCondensed Matter::Superconductivity0103 physical sciencestransport010306 general physics0210 nano-technologyEuS
researchProduct

Code Contracts ja ComTest-yksikkötestausgenerointi .NET-kielissä

2015

Opetuksen tehostamiseen suunnattu työkalu ComTest osaa luoda yksikkötestejä koodin kommentteihin kirjoitettujen ohjeiden perusteella. Sopimuspohjaisessa suunnittelussa olion metodeille asetetaan ehtoja, joiden on oltava voimassa ennen operaation suorittamista tai sen jälkeen. Tällaiset ehdot voidaan automaattisesti kirjoittaa osaksi koodin kommentteja. Code Contracts on laajennos .NET-kieliin, jonka avulla sopimuspohjainen suunnittelu saadaan osaksi sovelluskehitystä. Tutkimuksessa selvitetään, miten ComTest ja Code Contracts liittyvät toisiinsa. ComTest, a tool mainly directed to make teaching more efficient, is able to create Unit Tests based on directions written in the code comments. In…

.NET Ohjelmistokehys.NET FrameworkVB.NETSopimuspohjainen suunnitteluYksikkötestausC#Code ContractsComTest
researchProduct

Cryo-EM structure of ssDNA bacteriophage ΦCjT23 provides insight into early virus evolution.

2022

AbstractThe origin of viruses remains an open question. While lack of detectable sequence similarity hampers the analysis of distantly related viruses, structural biology investigations of conserved capsid protein structures facilitate the study of distant evolutionary relationships. Here we characterize the lipid-containing ssDNA temperate bacteriophage ΦCjT23, which infects Flavobacterium sp. (Bacteroidetes). We report ΦCjT23-like sequences in the genome of strains belonging to several Flavobacterium species. The virion structure determined by cryogenic electron microscopy reveals similarities to members of the viral kingdom Bamfordvirae that currently consists solely of dsDNA viruses wit…

/631/326/1321bacteriophagesviruksetcryoelectron microscopyevoluutioGeneral Physics and AstronomyelektronimikroskopiaDNA Single-Stranded/45/23FlavobacteriumGeneral Biochemistry Genetics and Molecular Biologybakteriofagit/631/45/535/1258/1259viral evolution/631/326/596/2554BacteriophagesMultidisciplinaryfylogenia/45fylogenetiikkaCryoelectron Microscopy/101/28articleGeneral Chemistryperimä1182 Biochemistry cell and molecular biologyCapsid Proteins
researchProduct

Parasite–copepod interactions in Svalbard: diversity, host specificity, and seasonal patterns

2022

AbstractCopepods of the genera Calanus and Pseudocalanus are important components of Arctic marine ecosystems. Despite the key roles of these zooplankters, little is known about the organisms they interact with most intimately, their parasites and symbionts. We applied metabarcode sequencing to uncover eukaryotic parasites present within these two copepod genera from three areas around the high Arctic archipelago of Svalbard. Ten distinct parasite groups were observed: four different Apostome ciliates, four different dinoflagellates (Chytriodinium sp., Ellobiopsis sp., Thalassomyces sp., and Hematodinium sp.), a Paradinium sp., and a trematode. Apostome ciliates closely related to Pseudocol…

/dk/atira/pure/sustainabledevelopmentgoals/life_below_waterPseudocalanus spp.ArcticCalanus glacialisfungiMetabarcodingVDP::Matematikk og Naturvitenskap: 400::Basale biofag: 470ParasitesSDG 14 - Life Below WaterGeneral Agricultural and Biological Sciences
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

The effect of plasma instabilities on the background impurities in charge breeder ECRIS

2017

International audience; Experimental observations of plasma instabilities in the 14.5 GHz PHOENIX charge breeder ECRIS are summarized. It has been found that the injection of 133Cs+ or 85Rb+ into oxygen discharge of the CB-ECRIS can trigger electron cyclotron instabilities, which results to sputtering of the surfaces exposed to the plasma, followed by up to an order of magnitude increase of impurity currents in the extracted n+ charge state distribution. The transition from stable to unstable plasma regime is caused by gradual accumulation and ionization of Cs/Rb altering the discharge parameters in 10 - 100 ms time scale, not by a prompt interaction between the incident ion beam and the EC…

010302 applied physicsMaterials scienceIon beamta114syklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Buffer gasCyclotronPlasmaElectroncharge breederplasmafysiikka7. Clean energy01 natural sciences010305 fluids & plasmaslaw.inventionIonECRISSputteringlawIonization0103 physical sciencesAtomic physicsplasma (kaasut)plasma
researchProduct

Recent improvements of the LPSC charge breeder

2017

International audience; PSC has developed the PHOENIX electron cyclotron resonance Charge Breeder since 2000. The performances have been improved over time acting on the 1+ and N+ beam optics, the base vacuum and the 1+ beam injection. A new objective is to update the booster design to enhance high charge state production and 1+ N+ efficiencies, reduce the co-extracted background beam and improve the ion source tunability. The first step, consisting in increasing the peak magnetic field at injection from 1.2 T to 1.6 T was implemented and significant improvement in 1+N+ efficiencies are reported: 12.9% of 23Na8+, 24.2% of 40Ar8+, 13.3% of 132Xe26+ and 13% of 133Cs26+. The next steps of the …

010302 applied physicsMaterials scienceta114Nuclear engineering[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]syklotronitCharge (physics)plasmatekniikka01 natural sciences7. Clean energy010305 fluids & plasmaselectron cyclotron resonanceBreeder (animal)0103 physical sciencesplasma
researchProduct

Deviation of H− beam extraction simulation model

2018

Negative hydrogen ion source extraction system development is dependent on accurate and fast simulation methods for modelling the behaviour of ion and electron beams. Traditionally this type of work has been done using ray-tracing extraction codes, such as IBSimu. The plasma extraction model in IBSimu has been observed to under-estimate the charge density near the plasma sheath, leading to incorrect prediction of the current at which the system produces the optimum emittance. It is suspected that this deviation results from the approximations made by the model, neglecting the magnetic field and collisional effects near the sheath region. Results and comparisons to simulations are presented …

010302 applied physicsMaterials scienceta114business.industryExtraction (chemistry)tietokonegrafiikkaplasmafysiikka01 natural sciencesOpticsion sourcesPhysics::Plasma Physicscomputer graphics0103 physical sciencessimulointi010306 general physicsbusinessBeam (structure)plasma sheaths
researchProduct