Search results for "IKK"

showing 10 items of 10819 documents

Mechanisms of Electron-Induced Single-Event Upsets in Medical and Experimental Linacs

2018

In this paper, we perform an in-depth analysis of the single-event effects observed during testing at medical electron linacs and an experimental high-energy electron linac. For electron irradiations, the medical linacs are most commonly used due to their availability and flexibility. Whereas previous efforts were made to characterize the cross sections at higher energies, where the nuclear interaction cross section is higher, the focus of this paper is on the complete overview of relevant electron energies. Irradiations at an electron linac were made with two different devices, with a large difference in feature size. The irradiations at an experimental linac were performed with varying en…

010302 applied physicsNuclear and High Energy PhysicsMaterials scienceta114010308 nuclear & particles physicselectronsElectron linacElectronhiukkaskiihdyttimetelektronitparticle accelerators01 natural sciencesLinear particle acceleratorNuclear physicsNuclear interactionradiation physicsCross section (physics)säteilyfysiikkaNuclear Energy and Engineering0103 physical sciencesElectrical and Electronic EngineeringEvent (particle physics)IEEE Transactions on Nuclear Science
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Charge breeding at GANIL: Improvements, results, and comparison with the other facilities

2019

International audience; The 1+/n+ method, based on an ECRIS charge breeder (CB) originally developed at the LPSC laboratory, is now implemented at GANIL for the production of Radioactive Ion Beams (RIBs). Prior to its installation in the middle of the low energy beam line of the SPIRAL1 facility, the 1+/n+ system CB has been modified based on the experiments performed on the CARIBU Facility at Argone National Laboratory. Later, it has been tested at the 1+/n+ LPSC test bench to validate its operation performances. Charge breeding efficiencies as well as charge breeding times have been measured for noble gases and alkali elements. The commissioning phase started at GANIL in the second half-y…

010302 applied physicsPhysicsTest benchRange (particle radiation)mechanical instrumentstutkimuslaitteetCyclotronThermal ionization01 natural sciences7. Clean energyIon source010305 fluids & plasmaslaw.inventionNuclear physicsion sourcesUpgradeBreeder (animal)Beamlinenuclear physicslawion beam mass spectrometer0103 physical sciences[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]ydinfysiikkaInstrumentation
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Diagrammatic Expansion for Positive Spectral Functions in the Steady-State Limit

2019

Recently, a method was presented for constructing self-energies within many-body perturbation theory that are guaranteed to produce a positive spectral function for equilibrium systems, by representing the self-energy as a product of half-diagrams on the forward and backward branches of the Keldysh contour. We derive an alternative half-diagram representation that is based on products of retarded diagrams. Our approach extends the method to systems out of equilibrium. When a steady-state limit exists, we show that our approach yields a positive definite spectral function in the frequency domain.

010302 applied physicsSteady state (electronics)Statistical Mechanics (cond-mat.stat-mech)non-equilibrium Green's functionsFOS: Physical sciences02 engineering and technologyPositive-definite matrix021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsDiagrammatic reasoningspectral propertiesFrequency domainProduct (mathematics)0103 physical sciencesApplied mathematicsLimit (mathematics)Perturbation theory (quantum mechanics)0210 nano-technologyRepresentation (mathematics)kvanttifysiikkaCondensed Matter - Statistical MechanicsMathematicsperturbation theory
researchProduct

The biased disc of an electron cyclotron resonance ion source as a probe of instability-induced electron and ion losses

2019

International audience; Electron Cyclotron Resonance Ion Source (ECRIS) plasmas are prone to kinetic instabilities resulting in loss of electron and ion confinement. It is demonstrated that the biased disk of an ECRIS can be used as a probe to quantify such instability-induced electron and ion losses occurring in less than 10 µs. The qualitative interpretation of the data is supported by the measurement of the energy spread of the extracted ion beams implying a transient plasma potential >1.5 kV during the instability. A parametric study of the electron losses combined with electron tracking simulations allows for estimating the fraction of electrons expelled in each instability event to be…

010302 applied physics[PHYS]Physics [physics]Materials sciencesyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]ElectronPlasmahiukkaskiihdyttimetKinetic energyplasmafysiikka01 natural sciencesInstabilityElectron cyclotron resonanceIon source010305 fluids & plasmasIonPhysics::Plasma Physics0103 physical sciencesTransient (oscillation)Atomic physicsInstrumentation
researchProduct

Estimating ion confinement times from beam current transients in conventional and charge breeder ECRIS

2019

International audience; Cumulative ion confinement times are probed by measuring decaying ion current transients in pulsed material injection mode. The method is applied in a charge breeder and conventional ECRIS yielding mutually corroborative results. The cumulative confinement time estimates vary from approximately 2 ms–60 ms with a clear dependence on the ion charge-to-mass ratio—higher charges having longer residence times. The long cumulative confinement times are proposed as a partial explanation to recently observed unexpectedly high ion temperatures. The results are relevant for rare ion beam (RIB) production as the confinement time and the lifetime of stable isotopes can be used f…

010302 applied physicsplasma sourcesMaterials scienceplasma diagnosticsIon beamStable isotope ratio[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Ion currentCharge (physics)plasmatekniikka7. Clean energy01 natural sciences010305 fluids & plasmasIonion sourcesplasma dischargesBreeder (animal)0103 physical sciencesAtomic physicsCurrent (fluid)InstrumentationBeam (structure)
researchProduct

Potential impacts of a future Nordic bioeconomy on surface water quality

2020

AbstractNordic water bodies face multiple stressors due to human activities, generating diffuse loading and climate change. The ‘green shift’ towards a bio-based economy poses new demands and increased pressure on the environment. Bioeconomy-related pressures consist primarily of more intensive land management to maximise production of biomass. These activities can add considerable nutrient and sediment loads to receiving waters, posing a threat to ecosystem services and good ecological status of surface waters. The potential threats of climate change and the ‘green shift’ highlight the need for improved understanding of catchment-scale water and element fluxes. Here, we assess possible bio…

010504 meteorology & atmospheric sciencesClimate ChangeVDP::Landbruks- og Fiskerifag: 900::Landbruksfag: 910Geography Planning and DevelopmentLand managementClimate changemaankäyttö010501 environmental sciences01 natural sciencesEnvironmental Effects of a Green Bio-EconomyEcosystem servicesVDP::Matematikk og Naturvitenskap: 400::Zoologiske og botaniske fag: 480::Økologi: 488Environmental ChemistryProduction (economics)Humans14. Life underwaterVDP::Landbruks- og Fiskerifag: 900::Fiskerifag: 920Ecosystem0105 earth and related environmental sciences2. Zero hungerBiomass (ecology)EcologyLand usebusiness.industryEnvironmental resource managementSurface waterGeneral Medicine15. Life on landModels TheoreticalvedenlaatuBioeconomy6. Clean waterWater qualitypintavesi13. Climate actionLand useEnvironmental scienceWater qualitybusinessbiotalousSurface waterForecasting
researchProduct

Ray optics for absorbing particles with application to ice crystals at near-infrared wavelengths

2018

Abstract Light scattering by particles large compared to the wavelength of incident light is traditionally solved using ray optics which considers absorption inside the particle approximately, along the ray paths. To study the effects rising from this simplification, we have updated the ray-optics code SIRIS to take into account the propagation of light as inhomogeneous plane waves inside an absorbing particle. We investigate the impact of this correction on traditional ray-optics computations in the example case of light scattering by ice crystals through the extended near-infrared (NIR) wavelength regime. In this spectral range, ice changes from nearly transparent to opaque, and therefore…

010504 meteorology & atmospheric sciencesOpacityspektroskopiaIce crystalsPhysics::OpticsRay optics01 natural sciencesPOLARIZED-LIGHT SCATTERING114 Physical sciencesLight scattering010309 opticsScatteringMEDIAOptics0103 physical sciencesABSORPTIONInhomogeneous wavesCIRRUSray opticsSpectroscopy0105 earth and related environmental sciencesPhysicsta113absorbing mediaRadiationta115Geometrical opticsIce crystalsta114Scatteringbusiness.industryscatteringCLOUDSkiteetRayAtomic and Molecular Physics and OpticsoptiikkaSOLAR-RADIATIONWavelengthMAXWELLS EQUATIONSAbsorbing mediainhomogeneous wavesLight scattering by particlesPHASE MATRIXGEOMETRIC-OPTICSbusinessice crystalsAPPROXIMATION
researchProduct

A risk assessment of the effects of mercury on Baltic Sea, Greater North Sea and North Atlantic wildlife, fish and bivalves

2021

Abstract: A wide range of species, including marine mammals, seabirds, birds of prey, fish and bivalves, were investigated for potential population health risks resulting from contemporary (post 2000) mercury (Hg) exposure, using novel risk thresholds based on literature and de novo contamination data. The main geographic focus is on the Baltic Sea, while data from the same species in adjacent waters, such as the Greater North Sea and North Atlantic, were included for comparative purposes. For marine mammals, 23% of the groups, each composing individuals of a specific sex and maturity from the same species in a specific study region, showed Hg-concentrations within the High Risk Category (H…

010504 meteorology & atmospheric sciences[SDV]Life Sciences [q-bio]Wildlifechemistry.chemical_elementAnimals WildMarine mammal:Matematikk og Naturvitenskap: 400::Zoologiske og botaniske fag: 480 [VDP]010501 environmental sciences01 natural sciencesRisk AssessmentRisk thresholdPredationMarine mammalbiology.animalAnimalsHumans14. Life underwaterBiological effectBiologylcsh:Environmental sciencesVDP::Mathematics and natural science: 4000105 earth and related environmental sciencesGeneral Environmental Sciencelcsh:GE1-350biologyBird of preyMarine mammal SeabirdFishesVDP::Matematikk og Naturvitenskap: 400SeabirdMercuryHgMercury (element)BivalviaFisheryChemistryGeographychemistryBaltic sea[SDE]Environmental SciencesNorth SeaBird of preySeabirdRisk assessment
researchProduct