Search results for "INR"

showing 10 items of 184 documents

Antike. Romantik. Rousseau. Interferenz in der Parkanlage Achilleion auf Korfu und in der privaten Lyrik der österreichischen Kaiserin Elisabeth

2015

cesarzowa Austrii ElżbietaAchilleion PalaceHeinrich HeinepoezjaJean-Jacques RousseauEmpress Elisabeth of AustriaPałac Achilleion
researchProduct

Participant characteristics associated with the effects of a physical and cognitive training program on executive functions

2022

Background: Physical and cognitive interventions have been shown to induce positive effects on older adults’ executive functioning. However, since participants with different background characteristics may respond differently to such interventions, we investigated whether training effects on executive functions were associated with sex, training compliance, and age. We also investigated if change in global cognition was associated with physical and cognitive training intervention-induced changes in executive functions. Methods: Exploratory data from a randomized controlled trial were analyzed. Participants were 70–85-year-old men and women who received a 12-month physical (PT) or physical a…

cognitionkognitiiviset taidottoiminnanohjaus (psykologia)human experimentphysical trainingmaletoimintakykyharjoittelucontrolled studyGerontologi medicinsk/hälsovetenskaplig inriktninghumanGerontology specialising in Medical and Health Sciencesolder adultstrail making testtrainingarticletraining responseinterventiotutkimusexecutive functions3141 Health care scienceagedfemaleexecutive functionexploratory researchrandomized controlled trialphysical and cognitive trainingikääntyneet
researchProduct

Un caso di pericardite recidivante colchicina-resistente

2023

La pericardite è una patologia infiammatoria del pericardio che si manifesta con dolore toracico e che spesso, ma non sempre, si associa a versamento pericardico. Rappresenta circa il 5% degli accessi in Pronto Soccorso (PS) per dolore toracico (di cui è la principale causa in età pediatrica). Le pericarditi si classificano a seconda della durata della sintomatologia o in base all’agente eziologico. A seconda della durata della sintomatologia si distinguono: forme acute, forme ricorrenti, quando si assiste a una ricomparsa dei sintomi dopo un periodo libero di almeno 6 settimane, e forme persistenti, quando i sintomi perdurano oltre le 6 settimane o quando si verifica una ricaduta del quadr…

colchicinapericardite recidivanteanakinra.
researchProduct

Generic Data Models for Semantic e-Government Interoperability : Literature Review

2014

Interoperability of e-government systems is suggested to increase transparency, efficiency, effectiveness, and customer service in the public sector. Generic data models are often seen as a way for achieving especially semantic interoperability. To assess how the contemporary data models support semantic egovernment interoperability, we reviewed literature on data models suggested for the public sector in light of four features: standard modelling language, entityrelationship modelling, vocabulary for data exchange and methodology. The review contributes previous research by introducing a four-feature framework for assessing capability of e-government data models to enhance interoperability…

data- och systemvetenskapSystemvetenskap informationssystem och informatik med samhällsvetenskaplig inriktningStatisticsInformation Systems Social aspectscomputer and systems sciencepublic administrationInteroperabilitydata modelcomputer and systems science - Informaticsdata- och systemvetenskap - InformatikStatistikinformation modelyhteentoimivuusjulkinen hallinto
researchProduct

Sosiaali-, terveys- ja kuntoutusalan opettajien digitaalinen osaaminen

2020

Tiivistelmä Tutkimuksen tarkoituksena oli kuvata sosiaali-, terveys- ja kuntoutusalan (soteku) opettajien (n=388) digitaalista osaamista osana TerOpe-hanketta. Aineisto kerättiin DigCompEdu CheckIn Self-reflection Tool -itsearviointityökaluun perustuvalla mittarilla, joka sisälsi 21 (strukturoitua) väittämää ja yhden avoimen kysymyksen. DigCompEdu-viitekehyksen kuutta osa-aluetta (ammatillinen sitoutuminen, digitaaliset resurssit, opettaminen ja oppiminen, arviointi, oppijoiden voimaannuttaminen ja oppijoiden digitaalisen osaamisen tukeminen) käytettiin sekä määrällisen aineiston keskiarvomuuttujien muodostamisessa että laadullisen aineiston deduktiivis-induktiivisen analyysin runkona. Opet…

digitaalinencompetencelärareyrkeshögskolorammatilliset oppilaitoksettietotekniikkadigital competenceammatilliset opettajatammattikorkeakoulutterveysalaundervisningkunnandedigitala läromedelammattitaitodigitaaliset taidotammatillisten opintojen opettajatdigitaalinen oppimateriaaliyrkesläroanstaltereducationteachersdigitalsocialsektornosaamisen kehittäminensoteku-alaopettajatopetushealth careyrkesskicklighetdigitaalitekniikkahälsovårdsbranscheneducatorkoulutusdigitalteknikosaaminensosiaalialarehabiliteringkuntoutusArtikkelitlärare i yrkesinriktade studierinformationsteknikHoitotiede
researchProduct

Measuring nuclear reaction cross sections to extract information on neutrinoless double beta decay

2017

Neutrinoless double beta decay (0v\b{eta}\b{eta}) is considered the best potential resource to access the absolute neutrino mass scale. Moreover, if observed, it will signal that neutrinos are their own anti-particles (Majorana particles). Presently, this physics case is one of the most important research "beyond Standard Model" and might guide the way towards a Grand Unified Theory of fundamental interactions. Since the 0v\b{eta}\b{eta} decay process involves nuclei, its analysis necessarily implies nuclear structure issues. In the NURE project, supported by a Starting Grant of the European Research Council (ERC), nuclear reactions of double charge-exchange (DCE) are used as a tool to extr…

double-beta decay: neutrinolessNuclear reactionHistoryParticle physicsdouble beta decayFOS: Physical sciencesnucleus: structure function[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]nuclear reaction7. Clean energy01 natural sciencesQUADRUPOLE MAGNETSEducationStandard Modelnucleus: productionPhysics and Astronomy (all)mass: scaleydinreaktiotFIELD MEASUREMENTdouble-beta decay: (0neutrino)Double beta decay0103 physical sciencesGrand Unified Theorystructureneutrino: massNuclear Experiment (nucl-ex)Nuclear Experiment010306 general physicsDETECTORNuclear ExperimentPhysicsoperator: transition010308 nuclear & particles physicsparticle: MajoranaOrder (ring theory)semileptonic decaycharge exchangeantiparticleComputer Science ApplicationsMAGNEX SPECTROMETER* Automatic Keywords *MAJORANAgrand unified theoryMAGNEX SPECTROMETER QUADRUPOLE MAGNETS FIELD MEASUREMENT DETECTOR.upgradeHigh Energy Physics::ExperimentProduction (computer science)NeutrinoJournal of Physics: Conference Series
researchProduct

Indigon sinisestä kokenillin punaiseen : tekstiilivärjäyksessä käytettyjen luonnonväriaineiden tuonti Suomeen (1791–1856)

2022

Tutkimme ulkomaisten luonnonväriaineiden tuontia Suomeen 1790-luvun alusta 1850-luvun puoliväliin. Ajankohtaa voidaan luonnehtia murroskaudeksi väriaineiden käytön historiassa. Selvitämme mitä väriaineita Suomeen tuotiin, millaisia määriä, minneniitä tuotiin sekä mistä satamista väriainelastit olivat lähtöisin. Lähdeaineistomme perustan muodostavat Tanskan Juutinrauman tullitilit, joista on koostettu suomalaisia satamia koskeva tietokanta (FIN-STRO: 1560/1791–1856). Lähdepohjaa on täydennetty muulla tilastoaineistolla sekä laadullisella materiaalilla, kuten värjäysoppailla ja Kansalliskirjaston digitaalisella sanomalehtiarkistolla. Tutkimme erityisesti sinistä, punaista ja keltaista väriä t…

dye stuffsväriaineettalousJuutinrauman tullitilittaloushistoriaEconomydyeingtuontitulli-ilmoituksetulkomaankauppavärjäysimportSound Toll RegistersSuomimuotikulutuskulttuuriforeign tradenineteenth centuryFinlandVertaisarvioitu artikkeli1800-lukukasvivärit
researchProduct

Die 'Blumen der Tugend' des Heinrich Schlüsselfelder. Edition und Untersuchung einer frühneuhochdeutschen Übersetzung des 'Fiore di Virtù' aus dem 15…

2022

En la presente tesis doctoral se realiza la edición de los textos Blumen der Tugend (Flores de la virtud) en su versión alemana en prosa del año 1468 del autor alemán Heinrich Schlüsselfelder. El trabajo se compone de una introducción al contexto histórico y literario, un estudio y descripción de los dos manuscritos existentes, tanto desde la perspectiva de su materialidad, así como de las características lingüísticas de los mismos; para a continuación presentar la transcripción diplomático-interpretativa de ambos textos completos manteniéndose lo más próxima posible a los manuscritos originales y realizando algunas intervenciones para facilitar su lectura. La proximidad y fidelidad al manu…

ediciónUNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASmanuscritosblumen der tugendheinrich schlüsselfelder:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]edad media tardíahumanismo temprano
researchProduct

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

Effect of lithium ions on the catalytic efficiency of calcium oxide as a nanocatalyst for the transesterification of lard oil

2019

The present work encompasses the effect of Li+ ions on CaO nanoparticles for the transesterification of lard oil. The modification of CaO nanoparticles was achieved by the impregnation of different molar ratios of lithium hydroxide. Later, each catalyst was screened for the catalytic conversion of lard oil to a fatty acid methyl ester (FAME). The nanocatalyst CaO–0.5LiOH (1 : 0.5 molar ratio) showed the best conversion rate for FAME. The synthesized nanocatalyst was characterized using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM), Brunauer–Emmett–Teller (BET) analysis, and Hammett indicato…

esterit020209 energyEnergy Engineering and Power Technologychemistry.chemical_element02 engineering and technologykalkki010501 environmental sciences01 natural sciencesLithium hydroxideCatalysischemistry.chemical_compoundkatalyytit0202 electrical engineering electronic engineering information engineeringFourier transform infrared spectroscopybiopolttoaineetFatty acid methyl ester0105 earth and related environmental scienceseläinrasvatRenewable Energy Sustainability and the EnvironmentTransesterificationFuel TechnologylitiumchemistryYield (chemistry)Proton NMRnanohiukkasetLithiumNuclear chemistrySustainable Energy & Fuels
researchProduct