Search results for "INRA"

showing 10 items of 84 documents

Mass Measurements of Proton-rich Nuclei with JYFLTRAP

2011

The Penning trap setup JYFLTRAP, connected to the IGISOL facility, has been extensively used for atomic mass measurements of exotic nuclei. On the proton rich side of the chart of nuclei mass measurements have mostly contributed to fundamental physics and nuclear astrophysics studies with about 100 atomic masses measured. peerReviewed

Condensed Matter::Quantum Gasesnuclear spectroscopyydinrakennenuclear physicsaccelerator-based physicsNuclear Theorynuclear structurePhysics::Atomic and Molecular ClustersydinspektroskopiaPhysics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Prospective Agriculture et Biodiversité - Inra - Département Environnement Agronomie

2009

Rapport sur expertiseEA; CT3; absent

EA[SDV] Life Sciences [q-bio][ SDV ] Life Sciences [q-bio][SDV]Life Sciences [q-bio]INRAagriculturebiodiversité
researchProduct

Laser spectroscopy of gallium isotopes beyond N = 50

2012

The installation of an ion-beam cooler-buncher at the ISOLDE, CERN facility has provided increased sensitivity for collinear laser spectroscopy experiments. A migration of single-particle states in gallium and in copper isotopes has been investigated through extensive measurements of ground state and isomeric state hyperfine structures. Lying beyond the N = 50 shell closure, 82Ga is the most exotic nucleus in the region to have been studied by optical methods, and is reported here for the first time. ispartof: pages:012071-6 ispartof: Journal of Physics: Conference Series vol:381 issue:1 pages:012071-6 ispartof: Rutherford Centennial Conference on Nuclear Physics location:Manchester, UK dat…

HistoryHyperfine structure of gallium isotopesIsotopes of copperCollinear laser spectroscopychemistry.chemical_elementMagnetic and quadrupole moments of gallium isotopeskiihdytinpohjainen fysiikkaEducationydinrakenneGalliumSpectroscopyNuclear ExperimentHyperfine structurenuclear spectroscopyIsotopeaccelerator-based physicsNuclear structureComputer Science ApplicationsCOLLAPS beam lineIsotopes of galliumchemistrynuclear structureydinspektroskopiaPhysics::Accelerator PhysicsAtomic physicsGround stateydinfysiikka
researchProduct

Choice of second-line disease-modifying antirheumatic drugs after failure of methotrexate therapy for rheumatoid arthritis: A decision tree for clini…

2009

Objective To survey rheumatologists' preferences for the choice of a second-line disease-modifying antirheumatic drug (DMARD) after inadequate response with methotrexate (MTX) therapy in rheumatoid arthritis (RA). Methods Thirty-six rheumatologists stated their preferences for RA treatment after inadequate response with MTX therapy (optimal dose at least 6 months). From the initial scenario, we derived 54 vignettes varying by rheumatoid factor or anti–cyclic citrullinated peptide antibody presence, swollen joint count, Disease Activity Score in 28 joints, and structural damage. Respondents stated their preference among 5 therapeutic options: MTX continuation, switch to another conventional …

MESH: Antirheumatic AgentsMESH: Decision TreesMESH: Treatment FailureArthritisMESH: Antibodies Anti-IdiotypicMESH: Logistic ModelsLogistic regressionSeverity of Illness IndexArthritis Rheumatoid0302 clinical medicineimmune system diseasesImmunology and AllergyMESH: Data CollectionPharmacology (medical)Treatment Failure030212 general & internal medicinePractice Patterns Physicians'skin and connective tissue diseasesMESH: Arthritis RheumatoidData CollectionAntibodies Anti-Idiotypic3. Good healthMESH: Interleukin 1 Receptor Antagonist ProteinMESH: Methotrexate[SDV.MHEP.RSOA]Life Sciences [q-bio]/Human health and pathology/Rhumatology and musculoskeletal systemAntirheumatic AgentsRheumatoid arthritismedicine.drugmusculoskeletal diseasesmedicine.medical_specialtyMESH: Rheumatoid FactorImmunologyPeptides Cyclic03 medical and health sciencesRheumatologyRheumatoid FactorMESH: Severity of Illness IndexInternal medicineSeverity of illnessmedicineHumansRheumatoid factorMESH: Physician's Practice PatternsMESH: Peptides Cyclic030203 arthritis & rheumatologyAnakinraMESH: HumansTumor Necrosis Factor-alphabusiness.industryDecision Treesmedicine.diseaseRheumatologyInterleukin 1 Receptor Antagonist ProteinLogistic ModelsMethotrexateMESH: Tumor Necrosis Factor-alphaPhysical therapyMethotrexatebusinessArthritis & Rheumatism
researchProduct

THE USE OF INTERLEUKIN 1 RECEPTOR ANTAGONIST (ANAKINRA) IN KAWASAKI DISEASE: A RETROSPECTIVE CASES SERIES

2018

Introduction: Persistent fever and inflammation after infusion of 2g/kg of IVIG, the standard treatment of KD represents a high-risk situation for coronary aneurysms in Kawasaki disease. Identifying patients at risk for IVIG resistance is difficult outside the Asian population, and there remains a critical unmet need to identify an anti-inflammatory treatment that is efficacious in all KD patients. Recent evidence from studies in animals and humans suggest a critical role for interleukin-1 (IL-1) α and β in the pathogenesis of KD. Objectives: To identify the clinical characteristics, reasons for use and response to treatment with anakinra in a retrospective series of patients with Kawasaki …

Male0301 basic medicineBLOCKADEPlacebo-controlled studyCHILDRENSUSCEPTIBILITYPLACEBO-CONTROLLED TRIALPediatricsDOUBLE-BLIND0302 clinical medicineSettore MED/38 - Pediatria Generale E SpecialisticaRetrospective StudieINTERLEUKIN 1 RECEPTOR ANTAGONIST ANAKINRA KAWASAKI DISEASEImmunology and AllergyJUVENILE IDIOPATHIC ARTHRITISChildPediatricAnakinra coronary artery aneurysmPrognosis1107 ImmunologyChild PreschoolDisease ProgressionFemaleVasculitisLife Sciences & BiomedicineHumanmedicine.drugVasculitismusculoskeletal diseasesAutoinflammatory diseaseVasculitimedicine.medical_specialtyMyocarditisPrognosiImmunologyMucocutaneous Lymph Node SyndromeAnakinra coronary artery aneurysms03 medical and health sciencesInternal medicineINFLIXIMABMANAGEMENTmedicineINTRAVENOUS IMMUNOGLOBULINHumansRetrospective Studies030203 arthritis & rheumatologyAnakinraScience & TechnologyKawasaki diseasebusiness.industryInfantReceptors Interleukin-1Retrospective cohort studymedicine.diseaseInfliximabInterleukin 1 Receptor Antagonist Protein030104 developmental biologyInterleukin 1 receptor antagonistKawasaki diseasebusinessInterleukin-1
researchProduct

Drug survival of anakinra and canakinumab in monogenic autoinflammatory diseases: observational study from the International AIDA Registry

2021

Abstract Objectives To investigate survival of IL-1 inhibitors in monogenic autoinflammatory disorders (mAID) through drug retention rate (DRR) and identify potential predictive factors of drug survival from a real-life perspective. Patients and methods Multicentre retrospective study analysing patients affected by the most common mAID treated with anakinra or canakinumab. Survival curves were analysed with the Kaplan-Meier method. Statistical analysis included a Cox-proportional hazard model to detect factors responsible for drug discontinuation. Results Seventy-eight patients for a total of 102 treatment regimens were enrolled. The mean treatment duration was 29.59 months. The estimated D…

Male0301 basic medicineTime FactorsSettore MED/16 - REUMATOLOGIAInterleukin-1beta0302 clinical medicineSettore MED/38 - Pediatria Generale E SpecialisticaMonoclonalPharmacology (medical)RegistriesHumanizedmedia_commonIL-1 anakinra canakinumab innovative biotechnologies monogenic autoinflammatory disorders personalized medicinepersonalized medicineMiddle AgedPenetranceTreatment OutcomeAnakinraAntirheumatic AgentsAutoinflammationIL-1; anakinra; canakinumab; innovative biotechnologies; monogenic autoinflammatory disorders; personalized medicine; Adult; Antibodies Monoclonal Humanized; Antirheumatic Agents; Female; Follow-Up Studies; Hereditary Autoinflammatory Diseases; Humans; Interleukin 1 Receptor Antagonist Protein; Interleukin-1beta; Male; Middle Aged; Retrospective Studies; Time Factors; Treatment Outcome; Young Adult; RegistriesFemalemedicine.drugAdultDrugmedicine.medical_specialtymedia_common.quotation_subjectAntibodies Monoclonal HumanizedcanakinumabAntibodiesYoung Adult03 medical and health sciencesinnovative biotechnologiesRheumatologyInternal medicinemedicineHumansAdverse effectSurvival analysismonogenic autoinflammatory disordersRetrospective Studies030203 arthritis & rheumatologyAnakinraIL-1business.industryHereditary Autoinflammatory DiseasesRetrospective cohort studyInterleukin 1 Receptor Antagonist ProteinCanakinumab030104 developmental biologyObservational studybusinessFollow-Up Studies
researchProduct

Kawasaki disease triggered by parvovirus infection: an atypical case report of two siblings.

2019

Abstract Background There are reports of the familial occurrence of Kawasaki disease but only a few reports described Kawasaki disease in siblings. However, the familial cases were not simultaneous. In these patients the idea of infective agents as trigger must be considered. Case presentation We describe two siblings with atypical presentations of Kawasaki disease; the sister was first diagnosed as having parvovirus infection with anemia and the brother was diagnosed as having myocarditis. The first patient was a 9-month-old Caucasian girl with fever, conjunctivitis, rash, and pharyngitis, and later she had cervical adenopathy, diarrhea and vomiting, leukocytosis, and anemia, which were ex…

Malemedicine.medical_specialtyAbdominal painViral MyocarditisMyocarditisCardiotonic AgentsDopaminelcsh:MedicineCase Report030204 cardiovascular system & hematologyGastroenterologyParvoviridae InfectionsParvovirus03 medical and health sciences0302 clinical medicineInternal medicineDobutaminemedicineHumansImmunologic FactorsLeukocytosisChildKawasaki diseasebusiness.industryMedicine (all)Siblingslcsh:RParvovirus infectionCoronary AneurysmInfantShockStroke VolumeGeneral MedicineKawasaki shock syndromemedicine.diseasePharyngitisInterleukin 1 Receptor Antagonist ProteinTreatment OutcomeAnakinraEchocardiography030220 oncology & carcinogenesisAnuriaKawasaki diseaseFemalemedicine.symptombusinessImmunosuppressive AgentsJournal of medical case reports
researchProduct

Low-spin excitations in the 109Tc nucleus

2012

Monoisotopic samples of ${}^{109}$Mo nuclei, produced in the deuteron-induced fission of ${}^{238}$U and separated using the IGISOL mass separator coupled to a Penning trap, were used to perform $\ensuremath{\beta}$- and $\ensuremath{\gamma}$-coincidence spectroscopy of ${}^{109}$Tc. Spin and parity 5/2${}^{+}$ for the ground state of ${}^{109}$Mo, proposed earlier, are supported in the present work. Three new low-energy levels observed in ${}^{109}$Tc are interpreted as bandheads of the $\ensuremath{\pi}3/{2}^{\ensuremath{-}}$[301], $\ensuremath{\pi}5/{2}^{\ensuremath{-}}$[303], and $\ensuremath{\pi}1/{2}^{+}$[431] configurations, respectively. A further three levels observed around 0.4 Me…

Nuclear and High Energy PhysicsFissionProlate spheroid[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]kiihdytinpohjainen fysiikka01 natural sciencesydinrakenneDouble beta decay0103 physical sciencesmedicine010306 general physicsSpectroscopynuclear spectroscopyPhysicsta114accelerator-based physics010308 nuclear & particles physicsParity (physics)medicine.anatomical_structurenuclear structureydinspektroskopiaAtomic physicsydinfysiikkaGround stateNucleusExcitation
researchProduct

High-accuracy mass spectrometry of fission products with Penning traps

2012

Mass measurements of fission products based on Penning-trap technique are reviewed in this article. More than 300 fission products have been measured with JYFLTRAP, ISOLTRAP, CPT, LEBIT and TITAN Penning traps with a typical precision of δm/m ≈ 10−7 − 10−8. In general, the results agree well with each other. The new data provide a valuable source of information and a challenge for the future development of theoretical mass models as well as for obtaining a deeper insight into microscopic properties of atomic nuclei as measured, for example, via key mass differentials. Shape transitions around N = 60, subshell closure at N = 40 and shell closures at N = 50 and N = 82 have been investigated i…

Nuclear and High Energy PhysicsNuclear TheoryMass spectrometry01 natural sciencesISOLTRAPkiihdytinpohjainen fysiikkaNuclear physicssymbols.namesakeydinrakenne0103 physical sciencesNuclear astrophysics010306 general physicsNuclear ExperimentPhysicsnuclear spectroscopyFission products010308 nuclear & particles physicsaccelerator-based physicsNuclear structure13. Climate actionPairingAtomic nucleusnuclear structuresymbolsydinspektroskopiaAtomic physicsTitan (rocket family)ydinfysiikka
researchProduct

Precision measurement of the magnetic octupole moment in 45Sc as a test for state-of-the-art atomic- and nuclear-structure theory

2020

We report on measurements of the hyperfine $A, B$ and $C$-constants of the $3d4s^2 ~^2D_{5/2}$ and $3d4s^2 ~^2D_{3/2}$ atomic states in $^{45}$Sc. High-precision atomic calculations of the hyperfine fields of these states and second-order corrections are performed, and are used to extract $C_{5/2}=-0.06(6)$ kHz and $C_{3/2}=+0.04(3)$ kHz from the data. These results are one order of magnitude more precise than the available literature. From the combined analysis of both atomic states, we infer the nuclear magnetic octupole moment $\Omega = -0.07(53) \mu_N b$, including experimental and atomic structure-related uncertainties. With a single valence proton outside of a magic calcium core, scan…

Nuclear and High Energy PhysicsoctupoleNuclear Theorynuclear density functional theory010308 nuclear & particles physicsPhysicsQC1-999tiheysfunktionaaliteoriaFOS: Physical sciences01 natural sciencesNuclear Theory (nucl-th)0103 physical sciencesnuclear structurePhysics::Atomic Physicsoktupooli ydinrakenneNuclear Experiment (nucl-ex)010306 general physicsydinfysiikkaNuclear Experiment
researchProduct