Search results for "INRA"

showing 10 items of 84 documents

Agriculture durable : « Les légumineuses ont un rôle à jouer »

2020

National audience

agroécologieINRA Dijon[SHS] Humanities and Social SciencesprotéagineuxComputingMilieux_MISCELLANEOUSvulgarisation[SHS]Humanities and Social Sciences
researchProduct

Microbes : 14 millions d’euros pour les chercheurs de la région

2021

L’université Bourgogne-Franche-Comté vient d’être lauréate d’un appel à projets qui va permettre à quelque 250 chercheurs de la région de bénéficier d’une manne de 14 millions d’euros, pour mener à bien des travaux sur les microbes.Laurent Philippot, directeur de recherche à l’Inrae, à Dijon, sera en charge de coordonner le projet Harmi en Bourgogne-Franche-Comté.

agroécologieINRA Dijon[SHS] Humanities and Social Sciencesvulgarisation
researchProduct

Avainrakenneanalyysillä uusia ikkunoita suomen oppimiseen

2016

avainrakenneanalyysikirja-arvostelutoppiminenkieletkielentutkimus
researchProduct

Un caso di pericardite recidivante colchicina-resistente

2023

La pericardite è una patologia infiammatoria del pericardio che si manifesta con dolore toracico e che spesso, ma non sempre, si associa a versamento pericardico. Rappresenta circa il 5% degli accessi in Pronto Soccorso (PS) per dolore toracico (di cui è la principale causa in età pediatrica). Le pericarditi si classificano a seconda della durata della sintomatologia o in base all’agente eziologico. A seconda della durata della sintomatologia si distinguono: forme acute, forme ricorrenti, quando si assiste a una ricomparsa dei sintomi dopo un periodo libero di almeno 6 settimane, e forme persistenti, quando i sintomi perdurano oltre le 6 settimane o quando si verifica una ricaduta del quadr…

colchicinapericardite recidivanteanakinra.
researchProduct

Indigon sinisestä kokenillin punaiseen : tekstiilivärjäyksessä käytettyjen luonnonväriaineiden tuonti Suomeen (1791–1856)

2022

Tutkimme ulkomaisten luonnonväriaineiden tuontia Suomeen 1790-luvun alusta 1850-luvun puoliväliin. Ajankohtaa voidaan luonnehtia murroskaudeksi väriaineiden käytön historiassa. Selvitämme mitä väriaineita Suomeen tuotiin, millaisia määriä, minneniitä tuotiin sekä mistä satamista väriainelastit olivat lähtöisin. Lähdeaineistomme perustan muodostavat Tanskan Juutinrauman tullitilit, joista on koostettu suomalaisia satamia koskeva tietokanta (FIN-STRO: 1560/1791–1856). Lähdepohjaa on täydennetty muulla tilastoaineistolla sekä laadullisella materiaalilla, kuten värjäysoppailla ja Kansalliskirjaston digitaalisella sanomalehtiarkistolla. Tutkimme erityisesti sinistä, punaista ja keltaista väriä t…

dye stuffsväriaineettalousJuutinrauman tullitilittaloushistoriaEconomydyeingtuontitulli-ilmoituksetulkomaankauppavärjäysimportSound Toll RegistersSuomimuotikulutuskulttuuriforeign tradenineteenth centuryFinlandVertaisarvioitu artikkeli1800-lukukasvivärit
researchProduct

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

Effect of lithium ions on the catalytic efficiency of calcium oxide as a nanocatalyst for the transesterification of lard oil

2019

The present work encompasses the effect of Li+ ions on CaO nanoparticles for the transesterification of lard oil. The modification of CaO nanoparticles was achieved by the impregnation of different molar ratios of lithium hydroxide. Later, each catalyst was screened for the catalytic conversion of lard oil to a fatty acid methyl ester (FAME). The nanocatalyst CaO–0.5LiOH (1 : 0.5 molar ratio) showed the best conversion rate for FAME. The synthesized nanocatalyst was characterized using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM), Brunauer–Emmett–Teller (BET) analysis, and Hammett indicato…

esterit020209 energyEnergy Engineering and Power Technologychemistry.chemical_element02 engineering and technologykalkki010501 environmental sciences01 natural sciencesLithium hydroxideCatalysischemistry.chemical_compoundkatalyytit0202 electrical engineering electronic engineering information engineeringFourier transform infrared spectroscopybiopolttoaineetFatty acid methyl ester0105 earth and related environmental scienceseläinrasvatRenewable Energy Sustainability and the EnvironmentTransesterificationFuel TechnologylitiumchemistryYield (chemistry)Proton NMRnanohiukkasetLithiumNuclear chemistrySustainable Energy & Fuels
researchProduct

Effect of different co-solvents on biodiesel production from various low-cost feedstocks using Sr–Al double oxides

2020

The main objective of the present paper comprises the investigation of biodiesel production from low-cost feedstock such as lard oil and waste cooking oil (WCO) using Sr-Al double oxides. Nanocatalyst was characterised FTIR, XRD, SEM, TEM, BET and XPS. The Sr:Al with 3:1 molar ratio showed the best catalytic activity in the conversion of both oils to fatty acid methyl ester. The effect of acetone and tetrahydrofuran (THF) as a co-solvent for transesterification were compared and the best result was obtained with 5 % THF. The mutual effect of the nanocatalyst and co-solvent on biodiesel production was investigated. The characterisation of biodiesel synthesised from lard oil and WCO was perfo…

kasviöljyt020209 energy02 engineering and technologyCatalysischemistry.chemical_compoundkatalyytit0202 electrical engineering electronic engineering information engineeringAcetone0601 history and archaeologySr–Al double oxidesFatty acid methyl esterBiodieselLard oil060102 archaeologyeläinrasvatRenewable Energy Sustainability and the Environmentfood and beveragesEN 1421406 humanities and the artsTransesterificationWaste cooking oilTransesterificationchemistryjätteiden hyötykäyttöBiodiesel productionnanohiukkasetMethanolBiodieselNuclear chemistry
researchProduct

INSAID Variant Classification and Eurofever Criteria Guide Optimal Treatment Strategy in Patients with TRAPS: Data from the Eurofever Registry

2021

Contains fulltext : 231528.pdf (Publisher’s version ) (Closed access) BACKGROUND: TNF receptor-associated periodic syndrome (TRAPS) is a rare autoinflammatory disease caused by dominant mutation of the TNF super family receptor 1A (TNFRSF1A) gene. Data regarding long-term treatment outcomes are lacking. OBJECTIVE: To assess correlations of genotype-phenotypes in patients with TRAPS, as defined by the International Study Group for Systemic Autoinflammatory Diseases (INSAID) classification and Eurofever criteria, with treatment responses. METHODS: Data from 226 patients with variants of the TNFRSF1A gene and enrolled in the Eurofever registry were classified according to the INSAID classifica…

medicine.medical_specialtyAbdominal painAutoinflammatory diseasesGroup AGroup BAA amyloidosis Anakinra Autoinflammatory diseases Colchicine TRAPS Abdominal Pain Colchicine FemaleHumans Mutation Registries Hereditary Autoinflammatory Diseases03 medical and health sciences0302 clinical medicineSettore MED/38 - Pediatria Generale E SpecialisticaAA amyloidosisTNF receptor-associated periodic syndrome (TRAPS) ; TNFRSF1A geneInternal medicinemedicineAA amyloidosisHumansImmunology and AllergyIn patientRegistries030212 general & internal medicineLikely pathogenicAnakinrabusiness.industryHereditary Autoinflammatory DiseasesTRAPSmedicine.diseaseAbdominal PainAnakinra030228 respiratory systemTNF receptor associated periodic syndromeMutationFemalemedicine.symptombusinessColchicineAA amyloidosis; Anakinra; Autoinflammatory diseases; Colchicine; TRAPSInflammatory diseases Radboud Institute for Molecular Life Sciences [Radboudumc 5]medicine.drug
researchProduct

THU0395 Adult Onset Still's Disease: A Multicenter Retrospective Cohort Study of 233 Italian Patients

2014

Background Adult onset Still9s disease (AOSD) is a rare rheumatic disease with an estimated prevalence of less than 1 case per 100,000 population. The diagnosis is difficult and is often delayed due to the lack of specific diagnostic tests and the need to rule out other pathological entities. Objectives To describe the clinical characteristics of a multicenter Italian case series of patients with AOSD. Methods 14 Italian University Hospital centers participated in the study. A standardized medical record containing clinical data, laboratory investigations, disease patterns and the different therapies has been sent to all participating centers. Each center collected data retrospectively. Res…

medicine.medical_specialtyAnakinraeducation.field_of_studybusiness.industryImmunologyPopulationRetrospective cohort studyRashGeneral Biochemistry Genetics and Molecular BiologyInfliximabSurgeryRheumatologyInternal medicinemedicineSore throatAdalimumabImmunology and Allergymedicine.symptombusinesseducationCohort studymedicine.drugAnnals of the Rheumatic Diseases
researchProduct