Search results for "INRA"

showing 10 items of 84 documents

Precision Mass Measurements beyond $^{132}$Sn: Anomalous behaviour of odd-even staggering of binding energies

2012

Atomic masses of the neutron-rich isotopes $^{121-128}$Cd, $^{129,131}$In, $^{130-135}$Sn, $^{131-136}$Sb, and $^{132-140}$Te have been measured with high precision (10 ppb) using the Penning trap mass spectrometer JYFLTRAP. Among these, the masses of four r-process nuclei $^{135}$Sn, $^{136}$Sb, and $^{139,140}$Te were measured for the first time. The data reveals a strong $N$=82 shell gap at $Z$=50 but indicates the importance of correlations for $Z>50$. An empirical neutron pairing gap expressed as the odd-even staggering of isotopic masses shows a strong quenching across $N$=82 for Sn, with the $Z$-dependence that is unexplainable by the current theoretical models.

nuclear spectroscopyydinrakenneTheoretical nuclear physicsaccelerator-based physicsnuclear structureydinspektroskopiaFOS: Physical sciencesNuclear Experiment (nucl-ex)ydinfysiikkakiihdytinpohjainen fysiikkaNuclear Experiment
researchProduct

Superfluid properties of the inner crust of neutron stars

2011

We investigated the superfluid properties of the inner crust of neutron stars, solving the Hartree-FockBogoliubov equations in spherical Wigner-Seitz cells. Using realistic two-body interactions in the pairing channel, we studied in detail the Cooper-pair and the pairing-field spatial properties, together with the effect of the proton clusters on the neutron pairing gap. Calculations with effective pairing interactions are also presented, showing significant discrepancies with the results obtained with realistic pairing forces. At variance with recent studies on finite nuclei, the neutron coherence length is found to depend on the strength of the pairing interaction, even inside the nucleus…

nuclear spectroscopyydinrakenneaccelerator-based physicsNuclear Theorynuclear structureydinspektroskopiaydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Nuclear mean-square charge radii of $^{63,64,66,68−82}$Ga nuclei: No anomalous behavior at N=32

2012

Collinear laser spectroscopy was performed on the 63,64,66,68−82Ga isotopes with neutron numbers from N = 32 to N = 51. These measurements were carried out at the ISOLDE radioactive ion beam facility at CERN. Here we present the nuclear mean-square charge radii extracted from the isotope shifts and, for the lighter isotopes, new spin and moment values. New ground-state nuclear spin and moments were extracted from the hyperfine spectra of 63,70Ga, measured on an atomic transition in the neutral atom. The ground-state spin of 63Ga is determined to be I = 3/2. Analysis of the trend in the change in mean-square charge radii of the gallium isotopes demonstrates that there is no evidence of anoma…

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaddc:530Physics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Prompt and delayed spectroscopy of 199At

2010

The neutron-deficient nucleus At199 has been studied through γ-ray and electron spectroscopy, using the recoil-decay tagging technique. Two experiments were conducted, using a gas-filled recoil separator with a focal-plane spectrometer alone and together with a germanium-detector array at the target position. The resulting level scheme for At199 includes a new isomer with a half-life of 0.80(5) μs and a spin and parity of (29/2+). The 13/2+ isomer, which de-excites via an M2 transition to the 9/2− ground state, was measured to have a half-life of 70(20) ns. Our earlier version of the level scheme for At197 has been updated as well. peerReviewed

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Structure of 115Ag studied by β− decays of 115Pd and 115mPd

2012

The excited levels of 115Ag have been studied via the beta decay of 115Pd and 115Pdm. The beta-decay schemes for both states have been considerably extended, especially the scheme following the decay of 115Pdm which was practically unknown before this work. Transition intensities and log10 f t values are reported, which have been missing in the literature. A set of levels around 2 MeV has been found to be strongly populated by the beta decay of the ground state of 115Pd and is suggested to have a three-quasiparticle nature. The properties of excited levels have been compared with the level systematics of lighter neutron-rich silver isotopes, and new spin assignments as well as identificatio…

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Candidate superdeformed band in 28Si

2012

Recent antisymmetrized molecular dynamics (AMD) calculations for 28Si suggest the presence of a superdeformed (SD) band with a dominant 24Mg + α clustering for its configuration, with firm predictions for its location and associated moment of inertia. This motivates a review of the experimental results reported in the literature with a particular focus on 24Mg(α,γ ) studies, as well as on α-like heavy-ion transfer reactions such as 12C(20Ne,α) 28Si. Combining this information for the first time leads to a set of candidate SD states whose properties point to their α-cluster structure and strong associated deformation. Analysis of data from Gammasphere allows the electromagnetic decay of thes…

nuclear spectroscopyydinrakenneaccelerator-based physicsnuclear structureydinspektroskopiaydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Fundamental movement skill proficiency and body composition measured by dual energy X-ray absorptiometry in eight-year-old children

2014

Objective: The main aim was to examine the association between fundamental movement skills (FMS) and objectively measured body composition using dual energy X-ray absorptiometry (DXA). Methods: Study of 304 eight-year-old children in Finland. FMS were assessed with the Test of Gross Motor Development, 2nd ed. (TGMD-2). Total body fat percentage (BF%), abdominal region fat percentage (AF%), and fat-free mass (FFM) were assessed by DXA. Waist circumference, height and weight were measured and International Obesity Task Force (IOTF) cut-off values for BMI were used for the definition of healthy weight and overweight/obesity. Results: Better FMS proficiency (object-control, locomotor, total FMS…

obesitymedicine.medical_specialtyWaistSocial PsychologyGross motor skillruumiinrakenne030209 endocrinology & metabolismOverweightPediatricsliikalihavuus03 medical and health sciences0302 clinical medicineClassification of obesityDevelopmental and Educational Psychologymedicineoverweightta315motoriset taidotfundamental movement skillsDual-energy X-ray absorptiometrykehonkoostumusDXAbody compositionmedicine.diagnostic_testmotor skillsylipaino030229 sport sciencesmedicine.diseaseCircumferenceObesityPhysical therapylihavuusmedicine.symptomPsychologyBody mass indexEarly Child Development and Care
researchProduct

Des chercheurs INRAE traquent les mutations de résistance aux herbicides à l’aide du séquençage à très haut débit. Newsletter SPE (Département INRAE …

2021

Les inhibiteurs de l’ALS en échec face à l’ambroisie à feuilles d’armoiseEn France, la résistance aux herbicides inhibiteurs de l’acétolactate-synthase (ALS) émerge chez l’ambroisie. Très utilisés car applicables sur la majorité des grandes cultures, ces produits phytosanitaires généralistes inhibent l’ALS, une enzyme clé des végétaux dans la synthèse d’acides aminés essentiels. Ils constituent la deuxième famille de désherbants la plus employée, et en paient le tribut : la résistance à cette classe d’herbicides a été identifiée dans plus de 160 espèces d’adventices, ou « mauvaises herbes ». Récemment rajoutée à cette liste, l’ambroisie à feuilles d’armoise (Ambrosia artemisiifolia) est une…

resistance[SDV] Life Sciences [q-bio]acetolactate-synthasenewsletter INRAEherbicidediagnosisgenotyping-by-sequencingillumina
researchProduct

Uncertainty analysis and symmetry restoration in nuclear self-consistent methods

2015

This thesis contains two articles, in the following denoted by I and II, and an introduction to them. In Chapter 1, I present the theoretical models of nuclear structure. In Chapter 2, I introduce the basic ideas about the density functional theory (DFT) and self-consistent mean-field (SCMF) calculations. In Chapter 3, I give the formulae for the uncertainty propagation, which is the error analysis method used in article I. As a proper tool to survey the predictive power of theoretical models, the error analysis now has become more and more widely used. By analyzing the propagation of uncertainties, one tries to find out the e ectiveness of the calculation with a given parameter set obtaine…

symmetriaydinrakenneenergiatiheysfunktionaalitnuclear density functional theorytiheysfunktionaaliteorianuclear structurepropagation of uncertaintyenergy-density-functionalssymmetry restorationmatemaattiset mallitydinfysiikkavirheanalyysi
researchProduct

Suomen ulkomaankaupan kasvu 1600-1800 -luvuilla : juutinrauman tullitilien uudelleenarviointi

2018

Työn tavoite on yhtenäistää Juutinrauman tullitiliaineistoja ja arvioida tullitilien käytettävyyttä Suomen ulkomaankaupan tutkimuksessa. Yhtenäistettyjen aikasarjojen pohjalta voidaan myös tarkastella Suomen – aikaisempaan tutkimukseen verrattuna pidemmän – pitkän aikavälin ulkomaankaupan kehitystä. Työssä rakennetaan uusi Suomea koskeva tietokanta FIN-STRO. Taustateoriana on siten lähtökohtaisesti ankkuroitua teoriaa (aineistopohjainen teoria, grounded theory) muistuttava lähestymistapa. Tutkimus hyödyntää Juutinrauman tullitilejä, joita laadittiin v. 1497–1857. Tutkimus koskee Suomen ulkomaankauppaa v. 1557–1856, jolloin suomalaisia satamia on kirjattu lähtösatamiksi Juutinrauman tullitil…

tuontivientiulkomaankauppatullitilittullitJuutinrauma1600-luku1700-luku1800-luku
researchProduct