Search results for "INS"

showing 10 items of 35719 documents

Discrete spectral incoherent solitons in nonlinear media with noninstantaneous response

2011

International audience; We show theoretically that nonlinear optical media characterized by a finite response time may support the existence of discrete spectral incoherent solitons. The structure of the soliton consists of three incoherent spectral bands that propagate in frequency space toward the low-frequency components in a discrete fashion and with a constant velocity. Discrete spectral incoherent solitons do not exhibit a confinement in the space-time domain, but exclusively in the frequency domain. The kinetic theory describes in detail all the essential properties of discrete spectral incoherent solitons: A quantitative agreement has been obtained between simulations of the kinetic…

01 natural sciencesoptical instabilitiesSchrödinger equation010309 opticssymbols.namesakeand lossesQuantum mechanics0103 physical sciencesDispersion (optics)Dynamics of nonlinear optical systemsOptical solitonssolitons010306 general physicsPropagationNonlinear Schrödinger equationNonlinear Sciences::Pattern Formation and SolitonsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]and optical spatio-temporal dynamicsscatteringWave equationAtomic and Molecular Physics and OpticsSupercontinuumNonlinear systemFrequency domainsymbolsoptical chaos and complexitySolitonnonlinear guided waves
researchProduct

Generalised bisection method for optimum ultrasonic ray tracing and focusing in multi-layered structures

2021

Ultrasonic testing has been used for many decades, proving itself very efficient for detecting defects in many industrial sectors. The desire to apply ultrasonic testing to geometrically complex structures, and to anisotropic, inhomogeneous materials, together with the advent of more powerful electronics and software, is constantly pushing the applicability of ultrasonic waves to their limits. General ray tracing models, suitable for calculating the proper incident angle of single element probes and the proper time delay of phased array, are currently required. They can support the development of new imaging techniques, as Full Matrix Capture and Total Focusing Method, and the execution of …

010302 applied physicsAcoustics and UltrasonicsComputer scienceIterative methodbusiness.industryTKComputationUltrasonic testing01 natural sciencesRay tracing (physics)Settore ING-IND/14 - Progettazione Meccanica E Costruzione Di MacchineSoftware0103 physical sciencesBisection methodUltrasonic wave propagation Ray tracing Mathematical modelling Bisection method Multi-layered structures Weld inspection CompositesA priori and a posterioriUltrasonic sensorbusiness010301 acousticsAlgorithmUltrasonics
researchProduct

Conic optical fiber probe for generation and characterization of microbubbles in liquids

2021

Abstract A novel optical fiber probe has been developed to provide mechanical stability to microbubbles generated in fluids, the tip of the fiber is etched with hydrofluoric acid to pierce a truncated horn that fastens the microbubbles to the fiber tip and prevents misalignment or detachment caused by convection currents, vibrations or shocks in the liquid. Microbubbles are photo-thermally generated on the etched fiber and used as Fabry-Perot cavity sensor. Two methods were used to interrogate the probe: the first one, in the wavelength domain, is suitable for calibration in static or quasi static situations; the second one, in the time domain, can be used in dynamic environments. Experimen…

010302 applied physicsConvectionMaterials sciencebusiness.industryMetals and Alloys02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsWavelengthOptics0103 physical sciencesMicrobubblesCalibrationFiberTime domainElectrical and Electronic Engineering0210 nano-technologybusinessInstrumentationQuasistatic processBar (unit)Sensors and Actuators A: Physical
researchProduct

Determining the deformation and resulting coupling efficiency degradation of ultrastable fiber-coupled optical benches under load.

2020

Fiber-coupled optical benches are an integral part of many laser systems. The base of such an optical bench is usually a slab of solid material, onto which optical components are fixed. In many environments, the ability to retain high fiber coupling efficiency under mechanical loads is essential. In this article, we study the fiber-to-fiber coupling efficiency under the application of static mechanical loads experimentally and theoretically: We constructed a simple three-point bending setup to interferometrically measure the deformation of an optical bench under load. Using the same setup, we further recorded the resulting coupling efficiency variations. The examined optical benches are bas…

010302 applied physicsCouplingMaterials scienceAcousticsPhysics::OpticsZerodurBendingDeformation (meteorology)Laser01 natural sciencesFinite element method010305 fluids & plasmaslaw.inventionlaw0103 physical sciencesSlabInstrumentationBeam (structure)The Review of scientific instruments
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Low energy nano diffraction (LEND) – A versatile diffraction technique in SEM

2019

Abstract Electron diffraction is a powerful characterization method that is used across different fields and in different instruments. In particular, the power of transmission electron microscopy (TEM) largely relies on the capability to switch between imaging and diffraction mode enabling identification of crystalline phases and in-depth studies of crystal defects, to name only examples. In contrast, while diffraction techniques have found their way into the realm of scanning electron microscopy (SEM) in the form of electron backscatter diffraction and related techniques, on-axis transmission diffraction is still in its infancy. Here we present a simple but versatile setup that enables a ‘…

010302 applied physicsDiffractionMaterials scienceGrapheneScanning electron microscopebusiness.industry02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesCrystallographic defectAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionCharacterization (materials science)Electron diffractionlawTransmission electron microscopy0103 physical sciencesOptoelectronics0210 nano-technologybusinessInstrumentationElectron backscatter diffractionUltramicroscopy
researchProduct

Fast-ADT: A fast and automated electron diffraction tomography setup for structure determination and refinement.

2020

Abstract Electron crystallography has focused in the last few years on the analyses of microcrystals, mainly organic compounds, triggered by recent publications on acquisition methods based on direct detection cameras and continuous stage tilting. However, the main capability of a transmission electron microscope is the access to features at the nanometre scale. In this context, a new acquisition method, called fast and automated diffraction tomography (Fast-ADT), has been developed in form of a general application in order to get the most of the diffraction space from a TEM. It consists of two subsequent tilt scans of the goniometric stage; one to obtain a crystal tracking file and a secon…

010302 applied physicsDiffractionMaterials scienceMicroscopeElectron crystallographybusiness.industryContext (language use)02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionDiffraction tomographyOpticsElectron diffractionlawGoniometer0103 physical sciences0210 nano-technologybusinessInstrumentationPowder diffractionUltramicroscopy
researchProduct

Quasi-parallel precession diffraction: Alignment method for scanning transmission electron microscopes.

2018

Abstract A general method to set illuminating conditions for selectable beam convergence and probe size is presented in this work for Transmission Electron Microscopes (TEM) fitted with µs/pixel fast beam scanning control, (S)TEM, and an annular dark field detector. The case of interest of beam convergence and probe size, which enables diffraction pattern indexation, is then used as a starting point in this work to add 100 Hz precession to the beam while imaging the specimen at a fast rate and keeping the projector system in diffraction mode. The described systematic alignment method for the adjustment of beam precession on the specimen plane while scanning at fast rates is mainly based on …

010302 applied physicsDiffractionMaterials sciencebusiness.industryDetector02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesDark field microscopyAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic Materialslaw.inventionOpticsElectron diffractionProjectorlaw0103 physical sciencesPrecessionElectron microscope0210 nano-technologybusinessInstrumentationBeam (structure)Ultramicroscopy
researchProduct

Preparation, Characterisation and Dielectric Properties of YBa2Cu3O7-δ/ Insulator-Heterostructures

1996

YBa 2 Cu 3 O 7-δ /insulator/Au-heterostructures on SrTiO 3 or LaAlO 3 substrates were prepared to study the properties of the materials SrTiO 3 , BaTiO 3 and Ceo 2 . X-ray diffraction measurements in Bragg-Brentano geometry show c-axis-oriented growth for the superconductor and the insulators SrTiO 3 and CeO 2 . Typical values for the rocking curve width of the different insulating films are between 0.4° and 0.8°. The highest breakdown fields are measured for the insulator SrTiO 3 with +37.5 kV/mm and -8.8 kV/mm. The permittivity for CeO 2 is independent of applied field and only weakly temperature dependent. This is in contrast to the perovskite type insulators, where the permittivity depe…

010302 applied physicsDiffractionPermittivitySuperconductivityMaterials scienceCondensed matter physicsGeneral Physics and AstronomyMineralogyHeterojunctionInsulator (electricity)02 engineering and technologyDielectric021001 nanoscience & nanotechnology01 natural sciencesCapacitancechemistry.chemical_compoundchemistry[PHYS.HIST]Physics [physics]/Physics archives0103 physical sciencesStrontium titanate0210 nano-technology
researchProduct

Analog isolated electronic dynamometer based on a magnetoresistive current sensor.

2017

In this work, an electronic system is presented to measure the force applied by a solenoid. The originality of the work is focused on the use of a magnetoresistive current sensor to provide the isolation barrier needed in the actual industrial plant where the solenoids are working. The design of the electronic system is presented as well as experimental measurements as a result of a calibration process showing a negligible hysteresis with that specific sensor. The magnetoresistive current sensor is used to develop transmission functions rather than playing its usual sensing roles.

010302 applied physicsDynamometerMagnetoresistancebusiness.industryComputer science010401 analytical chemistryElectrical engineeringProcess (computing)Solenoid01 natural sciences0104 chemical sciencesHysteresisNuclear magnetic resonanceTransmission (telecommunications)0103 physical sciencesCalibrationCurrent sensorbusinessInstrumentationThe Review of scientific instruments
researchProduct