Search results for "InP"

showing 10 items of 508 documents

On the Conditions of Price Consistency in the Input-Output Model

2013

The input-ouput model remains the basis of most SAM or CGE models. It actually uses two periods: the prices indexes solve it with the current period coefficients; the corresponding physical model is monoperiodic: the current prices solve it with the base period coefficients. The Leontief model is not consistent --- both models diverge generally --- unless the interindustry matrix of direct and indirect quantities of labor is stable over time. This implies that the vertically integrated labor coefficients are stable. This assumption is satisfied when the physical production coefficients and the physical labor coefficients are stable over time, two very strong assumptions.

Computable general equilibriumInput/outputMatrix (mathematics)Basis (linear algebra)Input–output modelConsistency (statistics)EconometricsEconomicsProduction (economics)Mathematical economicsVertical integrationSSRN Electronic Journal
researchProduct

Introduction: Digital Filters and Filter Banks

2015

A basic operation of spectr is filterin. In this introductory chapter, processing of one- and two-dimensional signals by digital filters and filter banks is outlined. A polyphase implementation of multirate filtering is described. The application of filtering with IIR filters, whose transfer functions are rational, is described. Bases and frames in the signals’ space that are generated by perfect reconstruction filter banks are discussed. The Butterworth filters, which are used in further constructions, are introduced.

Computer scienceElectronic engineeringPolyphase systemButterworth filterFilter (signal processing)Capacitor-input filterFilter bankTransfer functionInfinite impulse responseDigital filter
researchProduct

Image Inpainting Methods Evaluation and Improvement

2014

With the upgrowing of digital processing of images and film archiving, the need for assisted or unsupervised restoration required the development of a series of methods and techniques. Among them, image inpainting is maybe the most impressive and useful. Based on partial derivative equations or texture synthesis, many other hybrid techniques have been proposed recently. The need for an analytical comparison, beside the visual one, urged us to perform the studies shown in the present paper. Starting with an overview of the domain, an evaluation of the five methods was performed using a common benchmark and measuring the PSNR. Conclusions regarding the performance of the investigated algorith…

Computer scienceInpaintinglcsh:MedicineImage processingReview Articlelcsh:TechnologyGeneral Biochemistry Genetics and Molecular BiologyDomain (software engineering)Image (mathematics)Pattern Recognition AutomatedDigital image processingImage Interpretation Computer-AssistedImage Processing Computer-AssistedComputer visionlcsh:ScienceGeneral Environmental Sciencebusiness.industrylcsh:Tlcsh:RGeneral MedicineBenchmark (computing)Partial derivativelcsh:QArtificial intelligencebusinessAlgorithmsTexture synthesisThe Scientific World Journal
researchProduct

Touchless Interfaces For Public Displays

2016

Public displays have lately become ubiquitous thanks to the decreasing cost of such technology and public policies supporting the development of smart cities. Depending on form factor, those displays might use touchless gestural interfaces that therefore are becoming more often the subject of public and private research. In this paper, we focus on touchless interactions with situated public displays, and introduce a pilot study on comparing two interfaces: an interface based on the Microsoft Human Interface Guidelines (HIG), a de facto standard in the field, and a novel interface, designed by us. Differently from the HIG-based one, our interface displays an avatar, which does not require an…

Computer scienceInterface (computing)Public displaysPush-button02 engineering and technologycomputer.software_genreTouchless interfaceGestural inputPublic displayHuman–computer interaction020204 information systemsHuman interface guidelinesUser interface design0202 electrical engineering electronic engineering information engineeringGestural input; Public displays; Touchless interfaces; User interface design; Software; Human-Computer InteractionAvatarSettore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniFocus (computing)Multimedia020207 software engineeringUser interface designHuman-Computer InteractionTouchless interfacescomputerSoftwareDe facto standardGestureProceedings of the International Working Conference on Advanced Visual Interfaces
researchProduct

Developing hand-worn input and haptic support for real-world target finding

2019

Locating places in cities is typically facilitated by handheld mobile devices, which draw the visual attention of the user on the screen of the device instead of the surroundings. In this research, we aim at strengthening the connection between people and their surroundings through enabling mid-air gestural interaction with real-world landmarks and delivering information through audio to retain users' visual attention on the scene. Recent research on gesture-based and haptic techniques for such purposes has mainly considered handheld devices that eventually direct users' attention back to the devices. We contribute a hand-worn, mid-air gestural interaction design with directional vibrotacti…

Computer scienceNovel interaction paradigmMobile computingAugmented reality02 engineering and technologyInteraction designManagement Science and Operations ResearchGestural inputHuman–computer interactionNovel interaction paradigms020204 information systems0202 electrical engineering electronic engineering information engineeringAuditory feedback; Augmented reality; Gestural input; Haptic devices; Novel interaction paradigms; Pointing; Ubiquitous and mobile computing design and evaluationHaptic devicesHaptic technologySettore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniAuditory feedbackHaptic deviceSettore INF/01 - InformaticaUbiquitous and mobile computing design and evaluation020206 networking & telecommunicationsInteraction techniquePointingComputer Science ApplicationsHardware and ArchitectureAugmented realityMobile deviceAuditory feedbackGesturePersonal and Ubiquitous Computing
researchProduct

Vertical scratches detection based on edge detection for old film

2010

Automatic detection of image damaged regions is the key to automatic video image inpainting. Vertical scratches are the common damages in the old film. In this paper, a vertical scratches detection algorithm based on edge detection is proposed. The proposed algorithm first uses the operator which has the largest response to the vertical edge in Sobel operator to detect edges, and then uses canny operator to detect edges further. Third, we detect vertical lines in the image through probabilistic Hough transform. Finally, we obtain the true locations of the vertical lines scratches through morphology and width constraints. Many experiments show that our method can detect vertical line scratch…

Computer sciencebusiness.industryComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONInpaintingSobel operatorVertical barEdge detectionImage (mathematics)Operator (computer programming)Canny edge detectorComputer visionArtificial intelligencebusinessImage restorationMathematicsofComputing_DISCRETEMATHEMATICS2010 2nd International Conference on Industrial and Information Systems
researchProduct

3D Scene Reconstruction Using Kinect

2014

The issue of the automatic reconstruction of 3D scenes has been addressed in several chapters over the last few years. Many of them describe techniques for processing stereo vision or range images captured by high quality range sensors. However, due to the high price of such input devices, most of the methods proposed in the literature are not suitable for real-world scenarios. This chapter proposes a method designed to reconstruct 3D scenes perceived by means of a cheap device, namely the Kinect sensor. The scene is efficiently represented as a composition of superquadric shapes so as to obtain a compact description of environment, however complex it may be. The approach proposed here is i…

Computer sciencebusiness.industrymedia_common.quotation_subjectComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONInput deviceCognitive architectureScene Reconstruction 3D Data KinectReal imageRange (mathematics)StereopsisComputer visionQuality (business)Artificial intelligencebusinessmedia_common
researchProduct

Mass Measurements of Proton-rich Nuclei with JYFLTRAP

2011

The Penning trap setup JYFLTRAP, connected to the IGISOL facility, has been extensively used for atomic mass measurements of exotic nuclei. On the proton rich side of the chart of nuclei mass measurements have mostly contributed to fundamental physics and nuclear astrophysics studies with about 100 atomic masses measured. peerReviewed

Condensed Matter::Quantum Gasesnuclear spectroscopyydinrakennenuclear physicsaccelerator-based physicsNuclear Theorynuclear structurePhysics::Atomic and Molecular ClustersydinspektroskopiaPhysics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Metal artifact reduction in x-ray computed tomography: Inpainting versus missing value

2011

A comparison of algorithms for reduction of metal artifacts in x-ray cone beam computed tomography (CBCT) is presented. In the context of algebraic reconstruction techniques (ART) several inpainting algorithms in the image domain are evaluated against missing data strategies. A GPU-based iterative framework is employed for a meaningful comparison of both. Simulation results from an extended Shepp-Logan phantom and real world dental data are given.

Cone beam computed tomographyComputer sciencebusiness.industryComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONInpaintingContext (language use)Iterative reconstructionMissing dataMetal ArtifactComputer visionTomographyArtificial intelligencebusinessImage restorationComputingMethodologies_COMPUTERGRAPHICS2011 IEEE Nuclear Science Symposium Conference Record
researchProduct

Nuorten vankien lapsuuden väkivaltakokemukset ja heidän vanhempiensa parisuhdeongelmat

1999

Conflict Tactics Scaleskonfiguraatioanalyysilasten pahoinpitelyparisuhdeongelmatrikoksentekijä
researchProduct