Search results for "Instrumentation"

showing 10 items of 4914 documents

Prospects for advanced electron cyclotron resonance and electron beam ion source charge breeding methods for EURISOL

2011

International audience; As the most ambitious concept of isotope separation on line (ISOL) facility, EURISOL aims at producing unprecedented intensities of post-accelerated radioactive isotopes. Charge breeding, which transforms the charge state of radioactive beams from 1+ to an n+ charge state prior to postacceleration, is a key technology which has to overcome the following challenges: high charge states for high energies, efficiency, rapidity and purity. On the roadmap to EURISOL, a dedicated R&D is being undertaken to push forward the frontiers of the present state-of-the-art techniques which use either electron cyclotron resonance or electron beam ion sources. We describe here the gui…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceplasmafysiikka01 natural sciences7. Clean energyElectron cyclotron resonanceIonlaw.inventionIsotope separationelectron beamsNuclear physicsEURISOLion sourceslaw0103 physical sciencescyclotron resonance010306 general physicsradioactive ion beamsradioactive beamInstrumentation010302 applied physicsPhysicsta11429.25.Ni 41.75.Fr 07.77.KaionilähteetParticle acceleratorradioaktiiviset suihkutIon sourceCathode rayAtomic physicsydinfysiikkaIon cyclotron resonance
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

All-fibered high-quality low duty-cycle 160-GHz femtosecond pulse source

2008

International audience; In this paper, we report the experimental demonstration of an all-optical fiber-based 160-GHz femtosecond pulse source exhibiting a duty cycle as low as 1/17. The 380-fs wellseparated Gaussian pulses are generated thanks to the strong temporal compression of an initial beat-signal propagating into three distinct segments of optical fiber. Experimental results are supported by numerical simulations based on the generalized nonlinear Schrödinger equation. (© 2008 by Astro Ltd., Published exclusively by WILEY-VCH Verlag GmbH & Co. KGaA)

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Femtosecond pulse shapingOptical fiberPhysics and Astronomy (miscellaneous)GaussianFemtosecond02 engineering and technology01 natural scienceslaw.invention010309 opticssymbols.namesake020210 optoelectronics & photonicsQuality (physics)Opticslaw0103 physical sciences0202 electrical engineering electronic engineering information engineeringInstrumentationNonlinear Schrödinger equationComputingMilieux_MISCELLANEOUSPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]business.industryLow duty cyclePulse compressionDuty cyclePulse compressionFemtosecondsymbolsNonlinear optics in fibersOptoelectronicsbusiness
researchProduct

Si and Si-rich silicon-nitride waveguides for optical transmissions and nonlinear applications around 2 µm

2019

We show that cm-long silicon and silicon-rich silicon nitride waveguides with subwavelength transverse dimensions can efficiently sustain high-speed transmissions at 2 μm. We report the transmission of a 10 Gbit/s signal with negligible power penalty. Parametric conversion in both continuous and pulsed pump regimes is also demonstrated, as well as the spectral broadening of picosecond pulses.

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Materials scienceSiliconPhysics::Instrumentation and DetectorsPhysics::Opticschemistry.chemical_element02 engineering and technology01 natural sciencesSignal010309 opticsOptical pumpingchemistry.chemical_compound0103 physical sciencesComputingMilieux_MISCELLANEOUS[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]business.industryNonlinear optics021001 nanoscience & nanotechnologyTransverse planechemistrySilicon nitridePicosecondOptoelectronics0210 nano-technologybusinessDoppler broadening
researchProduct

Hyperfine structure of some near-infrared Xe I and Xe II lines

2011

International audience; This work reports on the experimental determination of the hyperfine splitting of the Xe I lines at 828.01 nm and 834.68 nm and the Xe II line at 834.72 nm. Measurements were performed by means of Doppler-free saturation spectroscopy in a low-pressure radio-frequency discharge. The absolute wavelength of all hyperfine components is obtained by way of a high-precision wavemeter backed-up with the absorption spectrum of the NO 2 molecule. We provide an accurate estimate of hyperfine constants for the lower level of the Xe II transition at 834.72 nm. The two Xe I transition outcomes of our experimental study are compared with data available in the literature.

[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Absorption spectroscopyNear-infrared spectroscopychemistry.chemical_element01 natural sciencesAtomic and Molecular Physics and Optics010305 fluids & plasmasAnalytical ChemistryWavelengthXenonchemistry[PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]0103 physical sciencesAtomic physics010306 general physicsSpectroscopyInstrumentationSaturation (magnetic)Hyperfine structureSpectroscopyLine (formation)
researchProduct

Micro-Raman investigation of X or gamma irradiated Ge doped fibers

2011

International audience; Micro-Raman spectra have been recorded on Ge doped optical fibers before and after 10 keV-X or c-ray irradiation up to doses of 1 MGy (X-ray) or 7.8 MGy (-ray). Our data provide evidence that, at such dose levels, the glass matrix is not modified in a detectable way. We observed that varying the Ge doping levels from 0 to about 11 wt.%, X or radiation sensitivity of the overall matrix remains unchanged. Such results are observed for fibers obtained with drawing conditions within the usual range used for the fabrication of specialty fibers as radiation-tolerant waveguides. Our data support the potentiality of fiberbased sensors using glass properties, e.g. Raman sc…

[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Nuclear and High Energy PhysicsOptical fiberFabricationMaterials scienceOptical fiberbusiness.industryDopingRadiation effectRadiation effectslaw.inventionMatrix (chemical analysis)symbols.namesakelawRaman spectroscopysymbolsOptical fiber; Drawing condition; Radiation effects; Raman spectroscopyOptoelectronicsIrradiationFiberRaman spectroscopybusinessInstrumentationDrawing conditionRaman scattering
researchProduct

Nonlinear sculpturing of optical pulses with normally dispersive fiber-based devices

2018

International audience; We present a general method to determine the parameters of nonlinear pulse shaping systems based on pulse propagation in a normally dispersive fiber that are required to achieve the generation of pulses with various specified temporal properties. The nonlinear shaping process is reduced to a numerical optimization problem over a three-dimensional space, where the intersections of different surfaces provide the means to quickly identify the sets of parameters of interest. We also show that the implementation of a machine-learning strategy can efficiently address the multi-parameter optimization problem being studied.

[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]Optimization problemGeneral methodComputer scienceFiber (mathematics)AcousticsProcess (computing)02 engineering and technologynonlinear fiber opticsSpace (mathematics)01 natural sciencesPulse shapingAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic MaterialsPulse propagation010309 opticsNonlinear system020210 optoelectronics & photonicsmachine learningControl and Systems Engineering0103 physical sciences0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringInstrumentationNonlinear shaping
researchProduct

The Detailed Science Case for the Maunakea Spectroscopic Explorer, 2019 edition

2019

(Abridged) The Maunakea Spectroscopic Explorer (MSE) is an end-to-end science platform for the design, execution and scientific exploitation of spectroscopic surveys. It will unveil the composition and dynamics of the faint Universe and impact nearly every field of astrophysics across all spatial scales, from individual stars to the largest scale structures in the Universe. Major pillars in the science program for MSE include (i) the ultimate Gaia follow-up facility for understanding the chemistry and dynamics of the distant Milky Way, including the outer disk and faint stellar halo at high spectral resolution (ii) galaxy formation and evolution at cosmic noon, via the type of revolutionary…

[PHYS]Physics [physics]Cosmology and Nongalactic Astrophysics (astro-ph.CO)Astrophysics::Instrumentation and Methods for AstrophysicsFOS: Physical sciencesAstrophysics::Cosmology and Extragalactic AstrophysicsAstrophysics - Astrophysics of Galaxies[PHYS] Physics [physics][SDU] Sciences of the Universe [physics][SDU]Sciences of the Universe [physics]Astrophysics of Galaxies (astro-ph.GA)Astrophysics::Earth and Planetary AstrophysicsAstrophysics - Instrumentation and Methods for AstrophysicsInstrumentation and Methods for Astrophysics (astro-ph.IM)Astrophysics::Galaxy AstrophysicsAstrophysics - Cosmology and Nongalactic Astrophysics
researchProduct

Radial electron fluence around ion tracks as a new physical parameter for the detection threshold of PADC using Geant4-DNA toolkit

2018

International audience; The detection threshold of poly(allyl dyglycol carbonate), PADC, for C ions is determined as 55 eV/nm in stopping power, which is significantly higher than that for proton and He ions. The stopping power is not a universal parameter for expressing the detection threshold of PADC. A new physical parameter of Radial Electron Fluence around Ion Tracks, REFIT, is proposed to describe the detection threshold of PADC. It is defined as the number density of electrons passing through the surface of a cylinder of a certain radius that is co-axial with the trajectory. Furthermore, preliminary calculations are presently being performed using the Monte Carlo simulation code of G…

[PHYS]Physics [physics]Detection thresholdRadiationMaterials scienceProtonGeant4-DNAIon trackLatent trackMonte Carlo methodREFIT02 engineering and technologyElectron021001 nanoscience & nanotechnologySecondary electronsPADC030218 nuclear medicine & medical imagingComputational physicsIon03 medical and health sciences0302 clinical medicineStopping power (particle radiation)Impact parameter0210 nano-technologyInstrumentationRadiation Measurements
researchProduct

Low-cost viscometer based on energy dissipation in viscous liquids

2001

We describe a new type of low-cost easy-to-use viscometer based on the temperature elevation in a liquid under shear flow. After calibration, this instrument can be used to measure the apparent steady state viscosity for both Newtonian and non-Newtonian liquids with no yield stress. We compute the rise in temperature due to viscous dissipation in a Couette cell and compare it to experimental results for different fluids. We show that the variation of the temperature with shear rate can be used to characterize the rheological behaviour of viscous fluids and to evaluate their viscosity in a large domain, from typically a few cP up to more than 10 P, with an accuracy of about ±5%. In contrast …

[PHYS]Physics [physics]Materials science[ PHYS ] Physics [physics]Applied MathematicsThermodynamicsViscometer02 engineering and technologyViscous liquidApparent viscosity021001 nanoscience & nanotechnology01 natural sciences[PHYS] Physics [physics]Condensed Matter::Soft Condensed MatterPhysics::Fluid DynamicsShear rateViscosityRheology0103 physical sciencesNewtonian fluid010306 general physics0210 nano-technologyShear flowInstrumentationEngineering (miscellaneous)ComputingMilieux_MISCELLANEOUS
researchProduct