Search results for "K+K"

showing 10 items of 14760 documents

Are we who we cite? : on epistemological injustices, citing practices, and #metoo in academia

2019

The #metoo movement reaching academia and Applied Linguistics creates a need for discussion on how we as scholars react to oppressive ideologies and behaviors in our community. However, this is not merely a question of processing cases of sexual harassment and assault. More deeply, we need conversations on who we do and do not know, read, and cite, and how to make our field more epistemologically equitable. This article hopes to elicit comments, reactions, and dialogue. nonPeerReviewed

#metootietoteoriaviitteetepistemological (in)justiceyhteiskunnalliset liikkeetciting practices
researchProduct

Colloquium: Nonequilibrium effects in superconductors with a spin-splitting field

2018

This Colloquium discusses the recent progress in understanding the properties of spin-split superconductors under nonequilibrium conditions. Recent experiments and theories demonstrate a rich variety of transport phenomena occurring in devices based on such materials that suggest direct applications in thermoelectricity, low-dissipative spintronics, radiation detection, and sensing. This text discusses different experimental situations and presents a theoretical framework based on quantum kinetic equations. This framework provides an accurate description of the nonequilibrium distribution of charge, spin, and energy, which are the relevant nonequilibrium modes, in different hybrid structure…

---General Physics and AstronomyLibrary scienceFOS: Physical sciences02 engineering and technologysuperconductors01 natural sciences7. Clean energysuprajohteetSuperconductivity (cond-mat.supr-con)Spin splitting0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)media_common.cataloged_instanceEuropean union010306 general physicskvanttifysiikkamedia_commonPhysicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter - SuperconductivityEuropean research021001 nanoscience & nanotechnologyquantum physicsCondensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct

Coexistence of superconductivity and spin-splitting fields in superconductor/ferromagnetic insulator bilayers of arbitrary thickness

2021

Ferromagnetic insulators (FI) can induce a strong exchange field in an adjacent superconductor (S) via the magnetic proximity effect. This manifests as spin splitting of the BCS density of states of the superconductor, an important ingredient for numerous superconducting spintronics applications and the realization of Majorana fermions. A crucial parameter that determines the magnitude of the induced spin splitting in FI/S bilayers is the thickness of the S layer d: In very thin samples, the superconductivity is suppressed by the strong magnetism. By contrast, in very thick samples, the spin splitting is absent at distances away from the interface. In this work, we calculate the density of …

---suprajohtavuusnanoelektroniikkaCondensed Matter - SuperconductivityEuropean researchOdd Triplet SuperconductivityFOS: Physical sciencesequation02 engineering and technologyPublic administration021001 nanoscience & nanotechnology01 natural sciences3. Good healthsuprajohteetSuperconductivity (cond-mat.supr-con)Spin splittingPolitical scienceCondensed Matter::Superconductivity0103 physical sciencestransport010306 general physics0210 nano-technologyEuS
researchProduct

Code Contracts ja ComTest-yksikkötestausgenerointi .NET-kielissä

2015

Opetuksen tehostamiseen suunnattu työkalu ComTest osaa luoda yksikkötestejä koodin kommentteihin kirjoitettujen ohjeiden perusteella. Sopimuspohjaisessa suunnittelussa olion metodeille asetetaan ehtoja, joiden on oltava voimassa ennen operaation suorittamista tai sen jälkeen. Tällaiset ehdot voidaan automaattisesti kirjoittaa osaksi koodin kommentteja. Code Contracts on laajennos .NET-kieliin, jonka avulla sopimuspohjainen suunnittelu saadaan osaksi sovelluskehitystä. Tutkimuksessa selvitetään, miten ComTest ja Code Contracts liittyvät toisiinsa. ComTest, a tool mainly directed to make teaching more efficient, is able to create Unit Tests based on directions written in the code comments. In…

.NET Ohjelmistokehys.NET FrameworkVB.NETSopimuspohjainen suunnitteluYksikkötestausC#Code ContractsComTest
researchProduct

Cádiz en Charcas: conjeturas e indicios

2012

Este es un artículo de historia constitucional. Se centra en la relación entre la Constitución española de 1812 y la Constitución boliviana de 1826. Su conclusión principal niega la idea de que, por el solo hecho de que ambas fueron cartas liberales contemporáneas entre sí escritas en la misma lengua, la primera Constitución haya influenciado en la segunda. Al contrario, toma a las semejanzas de redacción como un mero mecanismo de auxilio técnico, pero no por una fuente de influencia. Y, no las califica así, porque la influencia supone una relación de autoridad moralmente justificada, lo que, precisamente, estaba ausente entre el poder metropolitano y sus colonias. Una serie de documentos h…

//udcdata.info/021523 [http]Constitución de CádizHistorySociology and Political Sciencemedia_common.quotation_subjectConstitution of Bolivia of 1826Constitution of CadizSimon Bolivarlcsh:Law of EuropeCiencias jurídicasConstitucionalismo bolivarianolcsh:Law in general. Comparative and uniform law. JurisprudenceCiencias jurídicas. GeneralidadesSimón Bolívarmedia_common:CIENCIAS JURÍDICAS [UNESCO]DerechoConstitutionConstitución de Bolivia de 1826Artlcsh:KJ-KKZUNESCO::CIENCIAS JURÍDICASlcsh:K1-7720Independence WarGuerra de IndependenciaHumanitiesCartographyLawRevista de estudios histórico-jurídicos
researchProduct

Revisionismo histórico y racismo en la jurisprudencia constitucional : los límites de la libertad de expresión (a propósito de la STC 235/2007)

2007

Después de plantear la contradicción existente en la jurisprudenciaconstitucional que, por una parte, admite el revisionismo histórico conel límite del respeto a la dignidad y, por otra parte, reconoce con lamáxima amplitud la libertad ideológica, se analiza la STC 235/2007que ha declarado inconstitucional el delito de negación del genocidioy, en cambio, ha considerado constitucional la penalización de la justificacióndel genocidio. Esta sentencia ha clarificado parcialmente lasituación del revisionismo histórico y, en general, de la difusión de ideascontrarias a la Constitución pero sigue existiendo aquella contradicción;no obstante, ha aportado elementos como la distinción entreideas y ac…

//udcdata.info/021523 [http]Revisionismo históricoSociology and Political ScienceLlibertat d'expressiómedia_common.quotation_subjectLibertad de expresiónLibertad ideológicafreedom of thoughtlcsh:Law of Europedignitylcsh:Law in general. Comparative and uniform law. Jurisprudenceracismmedia_commonDignidadConstitutionDerechoPhilosophylcsh:KJ-KKZRacismofreedom of speechlcsh:K1-7720VenRacismehistorical revisionismLawHumanitiesCartographyRevista de Derecho Político
researchProduct

La forma de gobierno en la Constitución de Cádiz (reflexiones sobre la configuración de la Jefatura del Estado monárquica)

2012

A partir de las circunstancias históricas de las Cortes de Cádiz y de los precedentes de la monarquía española, el artículo analiza la posición de la Jefatura del Estado monárquica en la Constitución de 1812 caracterizada como una «Monarquía moderada» basada en los principios estructurales de soberanía nacional y división de poderes que determinan la configuración del Rey como poder constituido en la nueva forma de gobierno. La afirmación de la soberanía nacional impregna el conjunto del texto constitucional sin perjuicio de que coexista retóricamente con la antigua legitimidad monárquica. Por otra parte, la división de poderes supone la distinción entre la titularidad de la soberanía y su …

//udcdata.info/021523 [http]separation of powersSociology and Political ScienceParliamentmedia_common.quotation_subjectsoberanía nacionaldivisión de poderesConstitution of 1812lcsh:Law of EuropeConstitutional monarchyMonarchySovereigntylcsh:Law in general. Comparative and uniform law. Jurisprudencemonarquía parlamentariamedia_commonDret constitucionalDerechoConstitutionhead of statenational sovereigntySeparation of powersConstitucion de 1812lcsh:KJ-KKZArtExecutive branchconstitutional monarchylcsh:K1-7720Executive powerjefatura del estadoLawCartographyHumanities
researchProduct

Cryo-EM structure of ssDNA bacteriophage ΦCjT23 provides insight into early virus evolution.

2022

AbstractThe origin of viruses remains an open question. While lack of detectable sequence similarity hampers the analysis of distantly related viruses, structural biology investigations of conserved capsid protein structures facilitate the study of distant evolutionary relationships. Here we characterize the lipid-containing ssDNA temperate bacteriophage ΦCjT23, which infects Flavobacterium sp. (Bacteroidetes). We report ΦCjT23-like sequences in the genome of strains belonging to several Flavobacterium species. The virion structure determined by cryogenic electron microscopy reveals similarities to members of the viral kingdom Bamfordvirae that currently consists solely of dsDNA viruses wit…

/631/326/1321bacteriophagesviruksetcryoelectron microscopyevoluutioGeneral Physics and AstronomyelektronimikroskopiaDNA Single-Stranded/45/23FlavobacteriumGeneral Biochemistry Genetics and Molecular Biologybakteriofagit/631/45/535/1258/1259viral evolution/631/326/596/2554BacteriophagesMultidisciplinaryfylogenia/45fylogenetiikkaCryoelectron Microscopy/101/28articleGeneral Chemistryperimä1182 Biochemistry cell and molecular biologyCapsid Proteins
researchProduct

Parasite–copepod interactions in Svalbard: diversity, host specificity, and seasonal patterns

2022

AbstractCopepods of the genera Calanus and Pseudocalanus are important components of Arctic marine ecosystems. Despite the key roles of these zooplankters, little is known about the organisms they interact with most intimately, their parasites and symbionts. We applied metabarcode sequencing to uncover eukaryotic parasites present within these two copepod genera from three areas around the high Arctic archipelago of Svalbard. Ten distinct parasite groups were observed: four different Apostome ciliates, four different dinoflagellates (Chytriodinium sp., Ellobiopsis sp., Thalassomyces sp., and Hematodinium sp.), a Paradinium sp., and a trematode. Apostome ciliates closely related to Pseudocol…

/dk/atira/pure/sustainabledevelopmentgoals/life_below_waterPseudocalanus spp.ArcticCalanus glacialisfungiMetabarcodingVDP::Matematikk og Naturvitenskap: 400::Basale biofag: 470ParasitesSDG 14 - Life Below WaterGeneral Agricultural and Biological Sciences
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct