Search results for "LIX"

showing 10 items of 891 documents

Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

2020

 Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

filosofitkapitalismimetafysiikkatietotekniikkainformaatiokoneetkulttuurifilosofiayhteiskuntafilosofialuovuusteknologiaDeleuze GillessynteesiLektiotGuattari FélixmateriaalisuusAjatus
researchProduct

SOME COMPARATIVE REMARKS ON THE TRANSIENT CHANGE IN LACTIC ACID CONTENT IN SEA URCHIN EGGS FOLLOWING FERTILIZATION.

1964

Abstract During the first few minutes following fertilization a transient increase in the concentration of lactic acid occurs in the eggs of Arbacia lixula , whereas no change at all is observed in the eggs of Paracentrotus liuidus . In the eggs of Psammechinus miliaris there is a transient decrease, soon followed by a recovery so that the level of the unfertilized egg is again reached.

food.ingredientbiologyResearchPsammechinus miliarisCell Biologybiology.organism_classificationLactic acidchemistry.chemical_compoundfoodHuman fertilizationMetabolismchemistrybiology.animalFertilizationSea Urchinsembryonic structuresBotanyParacentrotusLactatesAnimalsLactic AcidSea urchinArbacia lixulaEchinodermataOvumExperimental cell research
researchProduct

Oligonucleotides-decorated-poly(N-vinyl pyrrolidone) nanogels for gene delivery

2013

Pulsed electron-beam irradiation of a semi-dilute poly(N-vinyl pyrrolidone) (PVP) aqueous solution in the presence of acrylic acid has led to a carboxyl functionalized nanogel system. Nanoparticles hydrodynamic size and surface charge density, in water and as a function of pH, were investigated by dynamic light scattering and laser doppler velocimetry, respectively. Nanogels (NGs) were proved not to be cytotoxic at the cellular level. Indeed, they rapidly bypass the cellular membrane to accumulate in specific cell portions of the cytoplasm, in the perinuclear area. The availability of pendant carboxyl groups on the crosslinked PVP NGs core prompted us to attempt their decoration with a sing…

gelAqueous solutionMaterials sciencePolymers and PlasticsirradiationOligonucleotidetechnology industry and agricultureNanoparticleGeneral ChemistryGene deliverybiomedical applications: gels; irradiationSurfaces Coatings and Filmschemistry.chemical_compoundDynamic light scatteringchemistryHelixPolymer chemistryMaterials Chemistrybiomedical applicationSettore CHIM/07 - Fondamenti Chimici Delle TecnologieAcrylic acidNanogel
researchProduct

Limiting climatic factors and habitats ofErica tetralixat the eastern edge of its distribution range

2015

We determined the limiting climatic factors, as well as the preferred habitats, of Erica tetralix L. at the eastern limit of its distribution range in the eastern Baltic region. It was found that E. tetralix in this region is a typical bog woodland plant preferring the wettest Sphagnum-rich sites. Northern Atlantic wet heath fragments, base-rich fens and species-rich Nardus grasslands were other habitats for the species. The species composition in E. tetralix habitats resembled that found in appropriate habitats within its main distribution range, although the habitats in the eastern Baltic region lack many Atlantic floristic elements characteristic of wet heath. A generalised linear model …

geographygeography.geographical_feature_categorybiologyEcologyRange (biology)Plant ScienceWoodlandbiology.organism_classificationErica tetralixFloristicsHabitatAgricultural landNardusBotanyBogEcology Evolution Behavior and SystematicsNordic Journal of Botany
researchProduct

Near-Infrared-Responsive Choline-Calix[4]arene-Gold Nanostructures for Potential Photothermal Cancer Treatment

2022

The development of novel chemical approaches for the fabrication of gold nanostructures with localized surface plasmon resonance (LSPR) falling in the near-infrared (NIR) region is one challenging topic in nanomaterials science. Due to their optical and photothermal properties triggered by light excitation in the therapeutic window (λmax = 650-1300 nm), gold-based nanostructures are appealing candidates in anticancer nanomedicine. Here, we report a novel method to prepare water-dispersible gold nanostructures with NIR-LSPR (λmax = 600-1000 nm) properties. The gold nanostructures were achieved in a single step by an unconventional method using NADH as a reducing agent and an amphiphilic chol…

gold nanostructuresphotothermal therapymolecular modelingSettore FIS/01 - Fisica SperimentalecalixareneGeneral Materials Sciencephotothermal effectcancer treatment
researchProduct

Biologic therapies versus conventional therapies. A series of Crohn’s disease patients: “a pair-matched study”

2011

infliximab crohn disease
researchProduct

Cyclosporine or infliximab as rescue therapy in severe 2 refractory ulcerative colitis: Early and long-term data 3 from a retrospective observational…

2012

Introduction: About 30–40% of patients with acute severe ulcerative colitis (UC) fail to respond 23 to intensive intravenous (iv) corticosteroid treatment. Iv cyclosporine and infliximab are an ef- 24 fective rescue therapy in steroid-refractory UC patients but up to now it is still unclear which is Q225 the best therapeutic choice in this setting of patients. 26 Methods: We reviewed our series of severe steroid-refractory colitis admitted consecutively in 27 our referral center since 1994 comparing two historical cohort treated with cyclosporine or 28 infliximab. Iv cyclosporine was administered at the dosage of 2 mg/kg and infliximab at the dos- 29 age of 5 mg/kg. The main outcome was the…

infliximabulcerative colitiscyclosporine
researchProduct

INFLIXIMAB FOR PEDIATRIC ULCERATIVE COLITIS:A RETROSPECTIVE ITALIAN MULTICENTER STUDY

2008

. Dig Liver Dis. 2008 Jul;40 Suppl 2:S260-4. Infliximab for pediatric ulcerative colitis: a retrospective Italian multicenter study. Cucchiara S, Romeo E, Viola F, Cottone M, Fontana M, Lombardi G, Rutigliano V, de'Angelis GL, Federici T. Division Pediatric Gastroenterology and Hepatology, Department of Pediatrics, University of Rome "La Sapienza", Rome, Italy. salvatore.cucchiara@uniroma1.it BACKGROUND: Infliximab (IFX), the chimeric anti TNFalpha antibody, an established treatment for Crohn's disease in adults and in children, is used less frequently in ulcerative colitis (UC). AIM OF THE STUDY: To report the clinical course of pediatric patients with active UC receiving IFX. PATIENTS AND…

infliximab.ulcerative colitis.
researchProduct

Viroporins, Examples of the Two-Stage Membrane Protein Folding Model

2015

Viroporins are small, α-helical, hydrophobic virus encoded proteins, engineered to form homo-oligomeric hydrophilic pores in the host membrane. Viroporins participate in multiple steps of the viral life cycle, from entry to budding. As any other membrane protein, viroporins have to find the way to bury their hydrophobic regions into the lipid bilayer. Once within the membrane, the hydrophobic helices of viroporins interact with each other to form higher ordered structures required to correctly perform their porating activities. This two-step process resembles the two-stage model proposed for membrane protein folding by Engelman and Poppot. In this review we use the membrane protein folding …

influenza A virus M2Protein Foldingviroporinslcsh:QR1-502ReviewBiologyhelix-helix packinglcsh:MicrobiologyCell membraneViral ProteinsVirologymedicinetransmembrane protein foldingAnimalsHumansmembrane insertionLipid bilayerCell MembraneVirologyTransmembrane proteinVirusFolding (chemistry)Transmembrane domainGenòmicaInfectious DiseasesMembranemedicine.anatomical_structureMembrane proteinVirus DiseasesVirusesBiophysicsProtein foldingProteïnesGenètica
researchProduct

Triple Helix modeļa pielietojuma iespējas starta uzņēmējdarbības vides veidošanā: Latvijas, Somijas un Igaunijas situāciju analīzes.

2016

Maģistra darba tēma ir Triple Helix modeļa pielietojuma iespējas starta uzņēmējdarbības vides veidošanā: Latvijas, Somijas un Igaunijas situāciju analīzes. Starta uzņēmējdarbība strauji attīstās visā pasaulē un aizvien pieaug to popularitāte un palielinās to nozīme valstu ekonomiku attīstībā. Šajā maģistra darbā tiek padziļināti pētītas un iepazītas trīs valstu starta uzņēmējdarbības vides, lai spētu izprast, kas starta uzņēmējdarbības vides padara veiksmīgas un efektīvas. Šī darba mērķis ir izveidot Latvijas Triple Helix modeli un to salīdzināt ar Igaunijas un Somijas Triple Helix modeļiem, lai varētu noteikt iemeslus kādēļ Latvijas starta uzņēmējdarbības vide atpaliek no iepriekšminēto va…

inkubatorsStarta uzņēmumsstarta uzņēmējdarbībaEkonomikaTriple - Helix modelisinovācijas
researchProduct