Search results for "LONG"

showing 10 items of 3969 documents

Analysis of HLA-DRB1,DQA1,DQB1 haplotypes in Sardinian centenarians

2008

Some genetic determinants of longevity might reside in those polymorphisms for the immune system genes that regulate immune responses. Many longevity association studies focused their attention on HLA (the human MHC) polymorphisms, but discordant results have been obtained. Sardinians are a relatively isolate population and represent a suitable population for association studies. Some HLA-DR and DQ alleles form very stable haplotypes with a strong linkage disequilibrium. In a previous study on Sardinian centenarians we have suggested that HLA-DRB1 *15 allele might be marginally associated to longevity. HLA-DR,DQ haplotypes are in strong linkage disequilibrium and well conserved playing a ro…

musculoskeletal diseasesAgingLinkage disequilibriummedia_common.quotation_subjectGenes MHC Class IILongevityPopulationBiologyBiochemistryArticleHLA-DQ alpha-ChainsLinkage Disequilibrium03 medical and health sciences0302 clinical medicineEndocrinologyGene FrequencyHLA-DQ AntigensGeneticsHLA-DQ beta-ChainsHumansskin and connective tissue diseaseseducationMolecular BiologyHLA-DRB1Allele frequencyComputingMilieux_MISCELLANEOUS030304 developmental biologyGenetic associationmedia_commonAged 80 and overGeneticsLikelihood Functions0303 health scienceseducation.field_of_studyPolymorphism GeneticHLA-DQB1HaplotypeLongevityHLA-DR AntigensCell BiologyHaplotypesItalyHLA Longevity SardiniaMedicineHLA-DRB1 Chains030215 immunologyExperimental Gerontology
researchProduct

Presence of Serum Antinuclear Antibodies Does Not Impact Long-Term Outcomes in Nonalcoholic Fatty Liver Disease

2020

Introduction We investigated the longitudinal impact of antinuclear antibody (ANA) on clinical outcomes and survival in nonalcoholic fatty liver disease (NAFLD). Methods ANA were found in 16.9% of 923 biopsy-proven NAFLD patients, but none of them had histologic autoimmune hepatitis (AIH) or developed AIH after a mean follow-up of 106±50 months. Results Although ANA-positive cases had a higher prevalence of nonalcoholic steatohepatitis at baseline, the occurrence of liver-related events, hepatocellula carcinoma, cardiovascular events, extrahepatic malignancy, and overall survival were similar to ANA-negative. Discussion Once AIH has been ruled out, the long-term outcomes and survival are un…

musculoskeletal diseasesMalemedicine.medical_specialtyAntibodies Antinuclear; Biopsy; England; Female; Humans; Italy; Longitudinal Studies; Male; Middle Aged; Non-alcoholic Fatty Liver Disease; Prevalence; Prospective Studies; Survival AnalysisAnti-nuclear antibodyBiopsySettore MED/12 - GASTROENTEROLOGIAAntibodies Antinuclear Biopsy EnglandFemale Humans Italy Longitudinal Studies Male Middle Aged Non-alcoholic Fatty Liver Disease Prevalence Prospective StudiesSurvival AnalysisAutoimmune hepatitisMalignancyGastroenterologyAntibodies03 medical and health sciences0302 clinical medicineimmune system diseasesNon-alcoholic Fatty Liver DiseaseInternal medicineAntinuclearBiopsyNonalcoholic fatty liver diseasemedicineCarcinomaPrevalenceHumansLongitudinal StudiesProspective Studiesskin and connective tissue diseasesProspective cohort studySurvival analysisHepatologymedicine.diagnostic_testbusiness.industryGastroenterologyMiddle Agedmedicine.diseaseSurvival Analysisdigestive system diseases3. Good healthstomatognathic diseasesn/aEnglandItaly030220 oncology & carcinogenesisAntibodies Antinuclear030211 gastroenterology & hepatologyFemalebusiness
researchProduct

Long Term Leisure Time Physical Activity Has a Positive Effect on Bone Mass Gain in Girls

2009

The purpose of this 7-year prospective longitudinal study was to examine whether the level and consistency of leisure-time physical activity (LTPA) during adolescence affected the bone mineral content (BMC) and bone mineral density (BMD) attained at early adulthood. The study subjects were 202 Finnish girls who were 10 to 13 years of age at baseline. Bone area (BA), BMC, and BMD of the total body (TB), total femur (TF), and lumbar spine (L2–L4) were assessed by dual-energy X-ray absorptiometry (DXA). Scores of LTPA were obtained by questionnaire. Girls were divided into four groups: consistently low physical activity (GLL), consistently high (GHH), and changed from low to high (GLH) and fro…

musculoskeletal diseasesmedicine.medical_specialtyLongitudinal studyAdolescentEndocrinology Diabetes and MetabolismLeisure timePhysical activityPhysiologyPhysical exerciseMotor ActivityBone and BonesAbsorptiometry PhotonLeisure ActivitiesBone DensitymedicineHumansOrthopedics and Sports MedicineFemurProspective StudiesChildUltrasonographyBone mineralbusiness.industrymusculoskeletal systemCalcaneusPhysical therapyFemaleLumbar spinebusinessBone massJournal of Bone and Mineral Research
researchProduct

Endocannabinoid Role in Synaptic Plasticity and Learning

2009

Endocannabinoids have recently emerged as versatile modulators of synaptic transmission and can act as retrograde neurotransmitters. As they cannot be stored in synaptic vesicles, endocannabinoid signaling is believed to start ‘on-demand,’ via a stimulus-dependent synthesis from membranous precursors at the postsynaptic site. After synthesis, endocannabinoids bind presynaptically to cannabinoid type 1 (CB1) receptors, leading to a short- or long-term suppression of neurotransmitter release. CB1 receptors are present in a plethora of different synaptic connections in the brain. Electrophysiological and behavioral analyses of mutant mice lacking CB1 receptors and of pharmacologically treated …

musculoskeletal neural and ocular physiologyfood and beveragesLong-term potentiationBiologyNeurotransmissionDepolarization-induced suppression of inhibitionchemistry.chemical_compoundnervous systemchemistrySynaptic plasticityMetaplasticitylipids (amino acids peptides and proteins)NeurotransmitterLong-term depressionNeurosciencepsychological phenomena and processesIon channel linked receptors
researchProduct

Bringing madness home : the multiple meanings of home in Janet Frame's Faces in the water, Bessie Head's A question of power and Lauren Slater's Proz…

2012

naisetkirjallisuusomaelämäkerrallisuusliteraturekotiaiheethomespacepsychiatrymielenterveyspsykiatrinen hoitomielenterveyshäiriötgenderhulluuswomen's madnessbelongingFeministinen kirjallisuudentutkimus
researchProduct

Women’s Multifaceted Citizenship : Identity, Belonging and Spaces of Participation in Rural Uganda

2022

This article analyses manifestations of women’s citizenship in diverse spaces of everyday participation in the rural districts of Kiboga and Namutumba in Uganda. Building on citizenship studies scholarship, we propose the notion of multifaceted citizenship, which ‘takes place’ in the same spaces of participation as processes of identity formation and belonging. Thus, our article also explores how identities and belonging manifest in spaces of participation. Drawing on content analysis of 50 qualitative interviews, we begin by investigating the spaces of participation that are experienced as meaningful by women. We then classify identities into five main categories: active resident, member, …

naisetmultifaceted citizenshipyhteisöllisyysafrikkalaisuusmaaseutuyhteisötrural Ugandakansalaisuusnaisen asemasukupuoliroolitUgandaidentiteettibelongingwomen’s citizenshipspaces of participationosallistuminen
researchProduct

Perceived goal setting practices across a competitive season

2019

Goal setting is an effective and frequently used tool for performance enhancement in sports. However, in the previous studies, the focus has been on goal effectiveness among individual male athletes and at one point in time. Therefore, the purpose of this longitudinal study was to examine goal setting practices in women’s sport teams across a competitive season from players’ individual and team perspectives. A total of 146 female players representing 24 teams in ice hockey, ringette, or floorball completed three online surveys. Surveys focused on setting outcome, process, and performance goals, as well as evaluating the follow-through of setting goals and actually reaching these goals acro…

naisurheilu050103 clinical psychologyLongitudinal studyTeam sportApplied psychologyfemale athletespitkittäistutkimuskilpaurheiluteam goalsIce hockey0501 psychology and cognitive sciencesjoukkueurheiluGoal settingharrastajatFocus (computing)biologyAthletesamateur sport05 social scienceslongitudinal studybiology.organism_classificationtavoitteetteam sportPerformance enhancementPsychologySocial Sciences (miscellaneous)
researchProduct

Morfologia e proprietà di fibre polimero/CNTs

2010

nanocompositi polimericiflusso elongazionale
researchProduct

Fibre a base di poliammide e nanotubi di carbonio: proprietà e morfologia

2012

nanotubi di carbonio poliammide flusso elongazionale
researchProduct

Distinguishing the Need to Belong and Sense of Belongingness: The Relation between Need to Belong and Personal Appraisals under Two Different Belongi…

2023

People are frequently caught in the hold between the need to belong and the fear of exclusion. However, these needs might be expressed differently under different belongingness conditions, where other powerful social processes are accentuated. Thus, the need to belong and social exclusion are concepts that are subjectively appraised based on one’s social relations. The present study aims to examine the relationship between the need to belong and five personal appraisals under two different belongingness conditions: (1) social-emotion support and (2) social-value representation. A total of 201 participants from two different groups were presented with 69 different items measuring five person…

need to belongClinical Psychologysocial-value representationVDP::Samfunnsvitenskap: 200::Psykologi: 260social exclusionDevelopmental and Educational Psychologyemotional self-expressionappraisalssocial relationsbelongingness-conditionssocial-worthinessApplied PsychologyEuropean Journal of Investigation in Health, Psychology and Education
researchProduct