Search results for "LSA"

showing 10 items of 832 documents

Angiotensin II antagonists - an assessment of their acute toxicity.

2013

In Germany, increasing prescription rates of angiotensin II antagonists resulted in rising enquiries to Poisons Information Centres (PICs) during the last decade. Therefore, we aimed to assess their acute toxicity for deriving triage recommendations.An observational case series with data collected retrospectively from eight PICs in Austria, Germany and Switzerland. Inclusion criteria were monoexposure, defined dose, and documented follow-up.In total, 206 cases of exposures to angiotensin II antagonists were included (candesartan, 94; eprosartan, 3; irbesartan, 20; losartan, 26; olmesartan, 16; telmisartan, 18; and valsartan, 29). The median dose expressed as a multiple of their maximum dail…

AdultMalemedicine.medical_specialtyPoison Control CentersTime FactorsPharmacologyToxicologyIrbesartanInternal medicineGermanymedicineHumansAntihypertensive AgentsRetrospective Studiesbusiness.industryPoisoningEprosartanGeneral MedicineMiddle AgedAngiotensin IILosartanValsartanChild PreschoolMedian bodyFemaleTelmisartanDrug OverdoseHypotensionbusinessOlmesartanAngiotensin II Type 1 Receptor Blockersmedicine.drugClinical toxicology (Philadelphia, Pa.)
researchProduct

Feasibility of cuff-free measurement of systolic and diastolic arterial blood pressure

2011

We validated a prototype cuff-free device for noninvasive estimation of blood pressure (BP). The system assumed a linear relation between BP values and the inverse of arterial blood pulse transit time, measured as time interval between the R wave on the electrocardiograph and the onset of the peripheral pulse wave on a finger plethysmogram. Thirty-three healthy subjects were analyzed at rest and during increasing stress exercise. To estimate subject-specific linear model parameters, the system was calibrated ad personam with reference to BP measures obtained by a cuff sphygmomanometer. High correlation values (R2= 0.89 and 0.78 for systolic and diastolic BP, respectively) and differences co…

AdultMalemedicine.medical_specialtySystoleDiastolePulse transit timeSphygmomanometerSensitivity and SpecificityQRS complexDiastoleInternal medicineValidationmedicineHumansDiagnosis Computer-AssistedSystolePhotoplethysmographyAccuracyAgedbusiness.industryReproducibility of ResultsBlood Pressure DeterminationEquipment DesignMiddle AgedSphygmomanometersConfidence intervalSurgeryBlood pressure monitoringEquipment Failure AnalysisBlood pressurePulsatile FlowCuffSettore ING-INF/06 - Bioingegneria Elettronica E InformaticaElectrocardiography AmbulatoryCardiologyNoninvasive measurementFeasibility StudiesArterial bloodFemalebusinessCardiology and Cardiovascular Medicine
researchProduct

Pulsatile and steady 24-h blood pressure components as determinants of left ventricular mass in young and middle-aged essential hypertensives

2003

In order to explore the relations between left ventricular mass (LVM) and the pulsatile (pulse pressure) and steady (mean pressure) components of the blood pressure (BP) curve, 304 young and middle-aged essential hypertensive patients were studied by means of 24-h ambulatory BP monitoring and echocardiography. In the overall study population, both the BP components showed significant correlations with LVM. These correlations were unevenly distributed in the subgroups of subjects younger and in those older than 50 years. While in this latter subgroup, in multivariate analysis, both 24-h mean BP (24-MBP) (beta = 0.27; P = 0.008) and 24-h pulse pressure (24-h PP) (beta = 0.23; P = 0.02) were a…

AdultMalemedicine.medical_specialtyTime FactorsAmbulatory blood pressureHeart diseaseSystoleHeart VentriclesStatistics as TopicPulsatile flowBlood PressureBody Mass IndexPredictive Value of TestsRisk FactorsAlbuminsInternal medicineStatistical significanceInternal MedicinemedicineHumansbusiness.industryAge FactorsMiddle Agedmedicine.diseaseCircadian RhythmPulse pressureMean blood pressureBlood pressureEndocrinologyItalyPulsatile FlowHypertensionMultivariate AnalysisPopulation studyFemalebusinessJournal of Human Hypertension
researchProduct

The PFO anatomy evaluation as possible tool to stratify the associated risks and the benefits arising from the closure

2010

Aims According to the current guidelines, the patent foramen ovale (PFO) is still considered a qualitative factor and, as a consequence, its closure is recommended just on the basis of its ‘presence’. Methods and results In the year 2008, we evaluated 25 patients (mean age 62.7) with acute cerebrovascular event and 92 patients (mean age 27.3) suffering from migraine with aura. No PFO was reported in 79 patients. A venous-to-arterial circulation shunt had been shown in 38 patients (29 subjects with migraine and 9 subjects with prior stroke). According to the number of microbubbles arrived during the Valsava manoeuvre, we found: 25 small PFO, 6 moderate PFO, and 6 severe PFO. In the baseline …

AdultMalemedicine.medical_specialtyValsalva ManeuverMigraine with AuraPopulationForamen Ovale PatentRisk AssessmentBrain IschemiaRisk FactorsIschaemic strokeConfidence IntervalsOdds RatiomedicineForamenHumansRadiology Nuclear Medicine and imagingeducationeducation.field_of_studybusiness.industryMean ageGeneral MedicineMiddle AgedPrognosismedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareMigraine with auraSurgeryItalyMigraineEchocardiographyCase-Control StudiesMultivariate AnalysisIschemic strokePatent foramen ovaleFemalePFOevaluationmedicine.symptomCardiology and Cardiovascular Medicinebusiness
researchProduct

Comparative neurocognitive effects of lithium and anticonvulsants in long-term stable bipolar patients

2015

Background: The aim of choosing a mood-stabilizing drug (lithium or anticonvulsants) or a combination of them with minimal neurocognitive effects is to stimulate the development of criteria for a therapeutic adequacy, particularly in Bipolar Disorder (BD) patients who are clinically stabilized. Method: Three groups of BD patients were established according to their treatment: (i) lithium monotherapy (n=29); (ii) lithium together with one or more anticonvulsants (n=28); and (iii) one or more anticonvulsants (n=16). A group of healthy controls served as the control (n=25). The following tests were applied: Wechsler Adult Intelligence Scale, Trail Making Test, Wechsler Memory Scale, Rey Comple…

AdultMalemedicine.medical_specialtyWechsler Memory ScaleBipolar DisorderTrail Making TestNeuropsychological TestsAudiologyExecutive FunctionYoung Adult03 medical and health sciences0302 clinical medicineVisual memoryWisconsin Card Sorting TestAntimanic AgentsmedicineHumansAttentionWorking memoryWechsler Adult Intelligence ScaleMiddle AgedExecutive functions030227 psychiatryPsychiatry and Mental healthClinical PsychologyMemory Short-TermLithium CompoundsAnticonvulsantsDrug Therapy CombinationFemaleCognition DisordersPsychologyNeurocognitive030217 neurology & neurosurgeryClinical psychologyJournal of Affective Disorders
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Lifestyle Habits and Mental Health in Light of the Two COVID-19 Pandemic Waves in Sweden, 2020

2021

The COVID-19 pandemic has become a public health emergency of international concern, which may have affected lifestyle habits and mental health. Based on national health profile assessments, this study investigated perceived changes of lifestyle habits in response to the COVID-19 pandemic and associations between perceived lifestyle changes and mental health in Swedish working adults. Among 5599 individuals (50% women, 46.3 years), the majority reported no change (sitting 77%, daily physical activity 71%, exercise 69%, diet 87%, alcohol 90%, and smoking 97%) due to the pandemic. Changes were more pronounced during the first wave (April–June) compared to the second (October–December). Women,…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectlcsh:Medicinephysical activityAnxietySittingArticlesmokingOddsHabitsEnvironmental healthPandemicMedicineHumansLife StylePandemicsDepression (differential diagnoses)media_commonSwedenbusiness.industryalcoholSARS-CoV-2Public healthallergologylcsh:RsittingCOVID-19Public Health Global Health Social Medicine and EpidemiologyVDP::Medisinske Fag: 700::Idrettsmedisinske fag: 850Mental healthFolkhälsovetenskap global hälsa socialmedicin och epidemiologihealth anxietyCross-Sectional StudiesdepressionAnxietyFemalePsychological resiliencesense organsmedicine.symptombusinessdietmental healthInternational Journal of Environmental Research and Public Health
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Blood flow velocity waveforms of the fetal middle cerebral artery in a normal population: reference values from 18 weeks to 42 weeks of gestation

2002

The aim of this prospective cross-sectional study was to establish new Doppler reference curves for peak blood flow velocities (Vmax, Vmean, Vmin) and impedance indices (PI, RI) of the middle cerebral artery at 18-42 weeks of gestation by an automatic wave form analysis integrated into the ultrasound device. In 962 low-risk pregnancies, blood flow velocities were derived from the middle cerebral artery with pulsed color Doppler ultrasonography. Reference curves were constructed for the individual parameters based on a growth function from a four-parameter class of monotonic continuous functions according to the smallest square principle for maximum blood flow velocities, as well as on a pol…

AdultMiddle Cerebral Arterymedicine.medical_specialtyPulsatile flowGestational AgeUltrasonography Prenatalsymbols.namesakeFetusPregnancymedicine.arteryInternal medicineLaser-Doppler FlowmetryHumansMedicineObserver VariationFetusbusiness.industryReproducibility of ResultsObstetrics and GynecologyGestational ageBlood flowAnatomyReference StandardsLaser Doppler velocimetryCross-Sectional StudiesPulsatile FlowPediatrics Perinatology and Child HealthMiddle cerebral arterysymbolsCardiologyGestationFemalebusinessDoppler effectBlood Flow VelocityJournal of Perinatal Medicine
researchProduct

Pulsatile versus continuous oxytocin infusion for the oxytocin challenge test.

1994

In a prospective study, 140 patients had an oxytocin challenge test with either a continuous or a pulsed infusion (one minute of infusion in every five minutes). Both infusion regimens had similar success rates in terms of uterine contractions (97.1 vs 98.6%). The potency ratio (pulsed versus continuous infusion) was significant at 2.7 (1.27 to 5.2), which means that more uterine activity was induced with each mU of oxytocin with pulsatile than with continuous administration. The total amount of oxytocin required to obtain three good contractions in 10 minutes was about 40% less with pulsed administration than with continuous infusion, but the test took 40 minutes longer with the pulsed tha…

AdultOxytocin challenge testContinuous infusionPulsatile flowOxytocinDrug Administration ScheduleUterine contractionUterine ContractionPregnancyMedicineHumansInfusions IntravenousInfusion PumpsUterine activityDose-Response Relationship Drugbusiness.industryPotency ratioInfant NewbornObstetrics and GynecologyGeneral MedicineDose–response relationshipOxytocinAnesthesiaPulsatile FlowFemalemedicine.symptombusinessmedicine.drugArchives of gynecology and obstetrics
researchProduct