Search results for "MAGNETIC FIELD"

showing 10 items of 1488 documents

Stability analysis of a paramagnetic spheroid in a precessing field

2019

Abstract The stability of a paramagnetic prolate or oblate spheroidal particle in a precessing magnetic field is studied. The bifurcation diagram is calculated analytically as a function of the magnetic field frequency and the precession angle. The orientation of the particle in the synchronous regime is calculated. The rotational dynamics and the mean rotational frequency in the asynchronous regime are also obtained. The theoretical model we describe enables the analytic calculation of the dynamics of the particle in the limiting case when the motion is periodic. The theoretical models were also compared with experimental results of rod like particle dynamics in a precessing magnetic field…

010302 applied physicsPhysicsField (physics)Dynamics (mechanics)02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter PhysicsBifurcation diagram01 natural sciencesStability (probability)Electronic Optical and Magnetic MaterialsComputational physicsMagnetic fieldParamagnetismOrientation (geometry)0103 physical sciencesParticle0210 nano-technologyJournal of Magnetism and Magnetic Materials
researchProduct

Efficiency of gyrotrons with a tapered magnetic field in the regime of soft self-excitation

2018

As a rule, gyrotron operation with high efficiency is realized in the regime of hard self-excitation that requires a special start-up scenario: either a tuning of the external magnetic field or providing certain relations between mod-anode and beam voltages. This paper describes a study of gyrotron operation in slightly tapered external magnetic fields. It is shown how the use of tapered magnetic fields affects the maximum efficiency realizable in hard and soft excitation regimes. First, a model of gyrotron with the Gaussian axial profile of the resonator field is studied. Then, a similar treatment is done for a realistic resonator designed for a 140 GHz Karlsruhe Institute for Technology g…

010302 applied physicsPhysicsField (physics)business.industryGaussianCondensed Matter Physics01 natural sciences010305 fluids & plasmaslaw.inventionMagnetic fieldResonatorsymbols.namesakeOpticsPhysics::Plasma PhysicslawGyrotron0103 physical sciencessymbolsbusinessExcitationBeam (structure)VoltagePhysics of Plasmas
researchProduct

Permanent magnet system to guide superparamagnetic particles

2017

A new concept of permanent magnet systems for guiding superparamagnetic particles on arbitrary trajectories is proposed. The basic concept is to use one magnet system with a strong and homogeneous (dipolar) magnetic field to magnetize and orient the particles. A second constantly graded field (quadrupolar) is superimposed to the first to generate a force. In this configuration the motion of the particles is driven solely by the component of the gradient field which is parallel to the direction of the homogeneous field. Then the particles are guided with constant force in a single direction over the entire volume. The direction can be adjusted by varying the angle between quadrupole and dipo…

010302 applied physicsPhysicsMagnetic momentCondensed matter physicsFOS: Physical sciences02 engineering and technologyMechanics021001 nanoscience & nanotechnologyCondensed Matter PhysicsPolarization (waves)Physics - Medical Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldDipoleMagnet0103 physical sciencesQuadrupoleVector fieldMedical Physics (physics.med-ph)0210 nano-technologyQuadrupole magnetJournal of Magnetism and Magnetic Materials
researchProduct

Synchronous precessional motion of multiple domain in a ferromagnetic nanowire by perpendicular field pulses

2014

Magnetic storage and logic devices based on magnetic domain wall motion rely on the precise and synchronous displacement of multiple domain walls. The conventional approach using magnetic fields does not allow for the synchronous motion of multiple domains. As an alternative method, synchronous current-induced domain wall motion was studied, but the required high-current densities prevent widespread use in devices. Here we demonstrate a radically different approach: we use out-of-plane magnetic field pulses to move in-plane domains, thus combining field-induced magnetization dynamics with the ability to move neighbouring domain walls in the same direction. Micromagnetic simulations suggest …

010302 applied physicsPhysicsMagnetization dynamicsMultidisciplinaryMagnetic domainCondensed matter physicsField (physics)Magnetic storageGeneral Physics and Astronomy02 engineering and technologyGeneral Chemistry021001 nanoscience & nanotechnology01 natural sciencesGeneral Biochemistry Genetics and Molecular BiologyDisplacement (vector)Articlelaw.inventionDomain (software engineering)Magnetic fieldNuclear magnetic resonanceDomain wall (magnetism)law0103 physical sciencesddc:5300210 nano-technologyNature Communications
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Analytical induced force solution in conducting cylindrical bodies and rings due to a rotating finite permanent magnet

2020

Abstract Using exact expression of the magnetic field we derive analytical expression for the induced current density and volume force in a solid conducting cylinder and ring due to a coaxial rotating finite permanent magnet with transverse magnetization. The integral torque is calculated from these expressions and validated with numerical and experimental results. Conditions for useful magnetic field approximations are found.

010302 applied physicsPhysicsRing (mathematics)02 engineering and technologyMechanics021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldMagnet0103 physical sciencesCylinderTorqueCoaxial0210 nano-technologyAxial symmetryCurrent densityJournal of Magnetism and Magnetic Materials
researchProduct

2019

We present a design for producing precisely adjustable and alternating single-axis magnetic fields based on nested Halbach dipole pairs consisting of permanent magnets only. Our design allows for three dimensional optical and mechanical access to a region with strong adjustable dipolar fields, is compatible with systems operating under vacuum, and does not effectively dissipate heat under normal operational conditions. We present a theoretical analysis of the properties and capabilities of our design and construct a proof-of-concept prototype. Using our prototype, we demonstrate fields of up to several kilogauss with field homogeneities of better than 5%, which are harmonically modulated at…

010302 applied physicsPhysicsScale (ratio)Field (physics)AcousticsPolarimetryGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMagnetic fieldGenerator (circuit theory)DipoleMagnet0103 physical sciences0210 nano-technologyVariable (mathematics)AIP Advances
researchProduct

Self-consistent non-stationary theory of the gyrotron

2016

For a long time, the gyrotron theory was developed assuming that the transit time of electrons through the interaction space is much shorter than the cavity fill time. Correspondingly, it was assumed that during this transit time, the amplitude of microwave oscillations remains constant. A recent interest to such additional effects as the after-cavity interaction between electrons and the outgoing wave in the output waveguide had stimulated some studies of the beam-wave interaction processes over much longer distances than a regular part of the waveguide which serves as a cavity in gyrotrons. Correspondingly, it turned out that the gyrotron theory free from the assumption about constant amp…

010302 applied physicsPhysicsWaveguide (electromagnetism)Plane (geometry)ElectronCondensed Matter Physics01 natural sciences010305 fluids & plasmaslaw.inventionMagnetic fieldAmplitudelawGyrotronQuantum electrodynamicsQuantum mechanics0103 physical sciencesConstant (mathematics)MicrowavePhysics of Plasmas
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct