Search results for "Manila"

showing 10 items of 13 documents

From Paris and Beijing to Washington and Brasilia: the grand design of capital cities and the early plans for Quezon City

2014

International audience; Political leaders have always sought to build monumental capitals, with earlier designs influencing those of later cities. The Western design that revolved around a central axis of power became evident in some Asian capitals, although cities in the Chinese cultural realm differed in shape but nonetheless had its own axis of power. This article provides a typology of capital cities and from this perspective it explores the design of the newly created capital of Quezon City in the late 1930s. Quezon City’s design embraced some design ideas from elsewhere, but it remained unique. However, the design was not realized entirely.

Cultural StudiesTypologyEconomic growthSociology and Political Science[SHS.GEO] Humanities and Social Sciences/Geography0211 other engineering and technologies02 engineering and technologyurban planning[ SHS.GEO ] Humanities and Social Sciences/GeographyPower (social and political)PoliticsBeijingUrban planningPolitical scienceRealm050602 political science & public administrationWashington DCComputingMilieux_MISCELLANEOUScapital citiesGeneral Arts and Humanities05 social sciencesPerspective (graphical)Quezon city021107 urban & regional planning[SHS.GEO]Humanities and Social Sciences/GeographyManila0506 political scienceEconomyCapital (economics)
researchProduct

Metro Manila’s competing business districts; Edge Cities, Philippine style ?

2016

International audience

Metro ManilaPhilippines[SHS.GEO] Humanities and Social Sciences/Geographyedge cities[SHS.GEO]Humanities and Social Sciences/GeographyWashingtion DCComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Metro Manila's challenges: flooding, housing and mobility

2014

International audience

MobilityFlooding[SHS.GEO] Humanities and Social Sciences/GeographyHousing[SHS.GEO]Humanities and Social Sciences/GeographyMetroManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes

2019

With the general objective indicated in its title, this work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippines, dependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the city, the conversion of many of them into traders of exotic products and singular slaves owners, and their collaboration to an incredible miscegenation due to the ethnic variety. On the other hand, to follow the footsteps of the first generation of residents in Manila, at the end of the 16th century and during the 17th century, this work gives us some information …

PhilippinesRevista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásolo [0210-9093 553 Estudis]and their collaboration to an incredible miscegenation due to the ethnic variety. On the other handAntonio With the general objective indicated in its titlesiglos xVI a xVIIIesclavitudfrom the 16th to the 18th centurywillsvida cotidianaat the end of the 16th century and during the 17th century:HISTORIA [UNESCO]vecinosdependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the cityMexicothis work gives us some information about the flexibility of the Hispanic Monarchy to adapt to the social surroundings in Asia. FilipinasUNESCO::HISTORIA0210-9093 553 Estudis: Revista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásoloto follow the footsteps of the first generation of residents in ManilaMéxicothe conversion of many of them into traders of exotic products and singular slaves ownersdaily lifeManilacommercethis work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippinesresidentscomerciotestamentosslavery 69 92
researchProduct

Metropolitan issues in Manila, Philippines

2010

[SHS.GEO] Humanities and Social Sciences/GeographyManilametro
researchProduct

Battling congestion in Manila : the EDSA problem

2013

National audience

[SHS.GEO] Humanities and Social Sciences/Geographytranspport[SHS.GEO]Humanities and Social Sciences/GeographyManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Les défis de la gouvernance urbaine à Manille

2014

La région capitale des Philippines est une des plus grandes aires urbaines du monde en termes de population. Le périmètre officiel du Grand Manille (17 municipalités) abrite environ 12 millions d’habitants et l’expansion périmétropolitaine porte le chiffre réel de Manille à 15 ou 16 millions d’habitants.La rapide croissance de l’aire urbaine depuis les années 1960 a conduit à de gros problèmes de gestion du logement, de la circulation, des déchets et des risques d’inondation, entre autres. Les phénomènes sont interdépendants.Créée sous Ferdinand Marcos, la National Capital Region fut gérée par son épouse Imelda Marcos, gouverneure du Grand Manille. Après la chute de la dictature, une volont…

gouvernance urbainePhilippines[SHS.GEO] Humanities and Social Sciences/GeographyGeography Planning and Development1. No poverty[SHS.GEO]Humanities and Social Sciences/GeographyManilaMetropolitan governanceUrban transport[ SHS.GEO ] Humanities and Social Sciences/GeographyRisk management11. SustainabilityManilletransports urbainsgestion des risquesgouvernance métropolitaineComputingMilieux_MISCELLANEOUSEarth-Surface Processes
researchProduct

Spaces of transit intermodality in Manila, Philippines

2013

International audience; Public transportation in the Philippines' capital Manila takes different forms : elevated subway (LRT and MRT systems) and ground transportation (provincial and local buses, jeepneys, trisikel and pedicabs, taxis). This presentation, based on field work in February, April and December 2012, will examine the characteristics of transfer/connecting areas between different modes of transportation (such as LRT to jeepneys, LRT to MRT, ...) in several locations of the Manila metropolitan area, in order to determine some of the problems making transfer difficult, but also the commercial activity generated by heavy pedestrian and passenger traffic in and around the transit c…

public transportcommercial areasintermodality[SHS.GEO] Humanities and Social Sciences/GeographyPhilippines[SHS.GEO]Humanities and Social Sciences/GeographyManila[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Smart sustainability challenges in Manila, Philippines

2016

International audience

smart sustainability[SHS.GEO] Humanities and Social Sciences/GeographyPhilippines[SHS.GEO]Humanities and Social Sciences/GeographyManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct