Search results for "Manila"

showing 10 items of 13 documents

Metro Manila’s competing business districts; Edge Cities, Philippine style ?

2016

International audience

Metro ManilaPhilippines[SHS.GEO] Humanities and Social Sciences/Geographyedge cities[SHS.GEO]Humanities and Social Sciences/GeographyWashingtion DCComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Battling congestion in Manila : the EDSA problem

2013

National audience

[SHS.GEO] Humanities and Social Sciences/Geographytranspport[SHS.GEO]Humanities and Social Sciences/GeographyManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Moving around the Philippines

2012

International audience; Visitors to Manila are quickly aware of the traffic jams and impediments to efficient transport within the capital region of the Philippines. Hours seem to be lost in traffic, and public transportation is very crowded. What are the reasons for these difficulties? Poor planning, lack of enforcement of the rules of circulation, an excessive rate of motorization, an insufficient development of quality public transit? What should be the role of "informal" transport (trisikel, pedicab, jeepneys) in a system of mobilities that should remain fair to all, rich and poor alike? The same set of questions arises for the mobility across the country. As an archipelago, and a count…

transportationPhilippines[SHS.GEO] Humanities and Social Sciences/Geographymegacity[SHS.GEO]Humanities and Social Sciences/GeographyManilaarchipelago[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Metro Manila's challenges: flooding, housing and mobility

2014

International audience

MobilityFlooding[SHS.GEO] Humanities and Social Sciences/GeographyHousing[SHS.GEO]Humanities and Social Sciences/GeographyMetroManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Smart sustainability challenges in Manila, Philippines

2016

International audience

smart sustainability[SHS.GEO] Humanities and Social Sciences/GeographyPhilippines[SHS.GEO]Humanities and Social Sciences/GeographyManilaComputingMilieux_MISCELLANEOUS[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

Spaces of transit intermodality in Manila, Philippines

2013

International audience; Public transportation in the Philippines' capital Manila takes different forms : elevated subway (LRT and MRT systems) and ground transportation (provincial and local buses, jeepneys, trisikel and pedicabs, taxis). This presentation, based on field work in February, April and December 2012, will examine the characteristics of transfer/connecting areas between different modes of transportation (such as LRT to jeepneys, LRT to MRT, ...) in several locations of the Manila metropolitan area, in order to determine some of the problems making transfer difficult, but also the commercial activity generated by heavy pedestrian and passenger traffic in and around the transit c…

public transportcommercial areasintermodality[SHS.GEO] Humanities and Social Sciences/GeographyPhilippines[SHS.GEO]Humanities and Social Sciences/GeographyManila[ SHS.GEO ] Humanities and Social Sciences/Geography
researchProduct

La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes

2019

With the general objective indicated in its title, this work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippines, dependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the city, the conversion of many of them into traders of exotic products and singular slaves owners, and their collaboration to an incredible miscegenation due to the ethnic variety. On the other hand, to follow the footsteps of the first generation of residents in Manila, at the end of the 16th century and during the 17th century, this work gives us some information …

PhilippinesRevista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásolo [0210-9093 553 Estudis]and their collaboration to an incredible miscegenation due to the ethnic variety. On the other handAntonio With the general objective indicated in its titlesiglos xVI a xVIIIesclavitudfrom the 16th to the 18th centurywillsvida cotidianaat the end of the 16th century and during the 17th century:HISTORIA [UNESCO]vecinosdependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the cityMexicothis work gives us some information about the flexibility of the Hispanic Monarchy to adapt to the social surroundings in Asia. FilipinasUNESCO::HISTORIA0210-9093 553 Estudis: Revista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásoloto follow the footsteps of the first generation of residents in ManilaMéxicothe conversion of many of them into traders of exotic products and singular slaves ownersdaily lifeManilacommercethis work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippinesresidentscomerciotestamentosslavery 69 92
researchProduct

Les défis de la gouvernance urbaine à Manille

2014

La région capitale des Philippines est une des plus grandes aires urbaines du monde en termes de population. Le périmètre officiel du Grand Manille (17 municipalités) abrite environ 12 millions d’habitants et l’expansion périmétropolitaine porte le chiffre réel de Manille à 15 ou 16 millions d’habitants.La rapide croissance de l’aire urbaine depuis les années 1960 a conduit à de gros problèmes de gestion du logement, de la circulation, des déchets et des risques d’inondation, entre autres. Les phénomènes sont interdépendants.Créée sous Ferdinand Marcos, la National Capital Region fut gérée par son épouse Imelda Marcos, gouverneure du Grand Manille. Après la chute de la dictature, une volont…

gouvernance urbainePhilippines[SHS.GEO] Humanities and Social Sciences/GeographyGeography Planning and Development1. No poverty[SHS.GEO]Humanities and Social Sciences/GeographyManilaMetropolitan governanceUrban transport[ SHS.GEO ] Humanities and Social Sciences/GeographyRisk management11. SustainabilityManilletransports urbainsgestion des risquesgouvernance métropolitaineComputingMilieux_MISCELLANEOUSEarth-Surface Processes
researchProduct

Filipinas en el marco del imperio español en el siglo XIX

2019

[EN] En este artículo se analiza la evolución de Filipinas en las últimas décadas del siglo XVIII y en el transcurso del siglo XIX a través de diferentes epígrafes: la obligada transformación del secular modelo colonial volcado hacia el tráfico del Galeón y las relaciones transpacíficas; la renovada inclinación hacia Asia, el océano Índico y el mar de China; el desarrollo de un sistema económico basado en la exportación de productos filipinos y en la apertura de las islas al exterior; la evolución de la vida política; el camino hacia la modernización; el peso de las órdenes religiosas, la importancia de la población china y la colaboración con élites indígenas como rasgos singulares de Fili…

the evolution of the political lifeUNESCO::HISTORIAthe Indian Ocean and the China Seasiglos XvIII y XIXthe importance of the Chinese population and the collaboration with indigenous elites as singular features of the Philippinesthe increase of conflicts and the path to revolution0210-9093 553 Estudis: Revista de historia moderna 529735 2019 45 7107713 Filipinas en el marco del imperio español en el siglo XIX Elizalde Pérez-Gruesothe renewed turn towards AsiaMaría Dolores This paper analyzes the evolution of the Philippines in the last decades of the eighteenth century and in the course of the nineteenth century through different epigraphs: the forced transformation of the secular colonial model addressed to the traffic of the Manila Galleon and transpacific relationsThe Philippine IslandsFilipinasthe road to modernizationand the US intervention that ended the Spanish sovereignty in the islands. Filipinas18th and 19th CenturiesRevista de historia moderna 529735 2019 45 7107713 Filipinas en el marco del imperio español en el siglo XIX Elizalde Pérez-Grueso [0210-9093 553 Estudis]the forced transformation of the secular colonial model addressed to the traffic of the Manila Galleon and transpacific relations [María Dolores This paper analyzes the evolution of the Philippines in the last decades of the eighteenth century and in the course of the nineteenth century through different epigraphs]imperio españolSpanish Empire:HISTORIA [UNESCO]Asia-PacíficoAsia and the PacificAsia and the Pacific. 93 116the development of an economic system based on the export of Filipino products and the opening of the islandsthe weight of religious orders
researchProduct