Search results for "Map"

showing 10 items of 3484 documents

Check in, check out! : käyttäytymisen tehostettua tukea lähikoulussa

2018

Finnish schools struggle with problem behaviour and need new interventions which are effective, acceptable, and can be implemented with high fidelity in general classrooms. The aim of this study was to examine the effects of Check in check out (CICO) support in decreasing the disruptive behaviours of general education primary school pupils. CICO can be regarded as an intensified level of support in Finnish schools, and its key features are brief morning and afternoon meetings with a CICO coach, the use of a Daily Report Card (DRC), regular positive feedback during the day by the classroom teacher, and parental involvement. The specific aims of the study were threefold: first, to pilot the i…

inclusive educationintensified supportpositive behavior supportkouluyhteisötoimintamallitoppilashuoltosingle-case experimental designkäyttäytymishäiriöterityinen tukipositiivinen pedagogiikkalähikouluperiaatekolmiportainen tukiADHDperuskouluinterventiontyöilmapiiri
researchProduct

Micro-scale post-fire surface cover changes monitored using high spatial resolution photography in a semiarid environment: A useful tool in the study…

2012

[ES] Although post-fire soil erosion has been studied, little attention has been paid to changes in soil surface cover following fires, despite this being a key factor in understanding the water and sediment yield. This study, at Peñaflor (Spain), investigated the effect of fire on soil erosion using data from soil erosion plots and high spatial resolution photography (HSRP). Measurements were made from October 2003 to October 2005 in a control plot and a plot experimentally exposed to a fire in October 2004. Ground cover components were identified, including vegetation, bare soil, stones, charcoal and ash. Runoff and sediment concentrations were low because of the absence of intense rainfa…

inorganic chemicalsHydrologyEcologySedimentSoil scienceVegetationrespiratory systemcomplex mixturesRock fragmentvisual_artErosionLittervisual_art.visual_art_mediumEnvironmental scienceScale (map)CharcoalSurface runoffEcology Evolution Behavior and SystematicsEarth-Surface Processes
researchProduct

The fnr Gene of Bacillus licheniformis and the Cysteine Ligands of the C-Terminal FeS Cluster

1998

Many of the O2-responsive gene regulators of bacteria are members of the fumarate nitrate reductase-cyclic AMP receptor protein family of transcriptional regulators (12, 13, 15, 17) with predicted structures similar to those of the cyclic AMP receptor protein (11). The Fnr (stands for fumarate nitrate reductase regulator) protein from Escherichia coli (FnrEc) controls the expression of a variety of genes, mainly of anaerobic respiration and metabolism (5, 13). It contains a N-terminal cluster of three essential cysteine residues which are supposed to bind together with Cys122 a [4Fe 4S]2+ cluster which is required for O2 sensing (4, 7, 8, 10, 16). A wide variety of gram-negative bacteria co…

inorganic chemicalsIron-Sulfur ProteinsMolecular Sequence DataRestriction MappingMutantBacillusGenetics and Molecular BiologySequence alignmentmacromolecular substancesBacillus subtilisLigandsNitrate reductaseenvironment and public healthMicrobiologyBacterial ProteinsAmino Acid SequenceCysteineBacillus licheniformisMolecular BiologyPeptide sequenceBacillus megateriumSequence Homology Amino AcidbiologyEscherichia coli ProteinsGene Expression Regulation Bacterialbiology.organism_classificationenzymes and coenzymes (carbohydrates)KineticsBiochemistryBacillus megateriumbacteriaSequence AlignmentBacillus subtilisTranscription FactorsCysteineJournal of Bacteriology
researchProduct

Mapeo transversal de competencias en los títulos de grado

2021

Documento de trabajo para la revisión de títulos de grado en relación a las competencias, generales, específicas y básicas, y los resultados de aprendizaje. Documento de trabajo para realizar un mapeo de competencias, generales y específicas, de los títulos de grado en relación con los resultados de aprendizaje. El instrumento de mapeo competencial transversal puede ser una herramienta que adaptada, a cada caso particular, sea un soporte de diagnóstico válido para nuevos trabajos de revisión de titulaciones universitarias. Work document to carry out a competences, general and specific, mapping of the degree titles in relation to the learning results. The cross competences mapping tool can b…

instrumento de diagnósticoUNESCO::SOCIOLOGÍAmapeo competenciascompetencias específicasresultados de aprendizajetítulos de gradocompetencias generales:SOCIOLOGÍA [UNESCO]revisión títulosmapeo competencial transversal
researchProduct

On modified α-ϕ-fuzzy contractive mappings and an application to integral equations

2016

Abstract We introduce the notion of a modified α-ϕ-fuzzy contractive mapping and prove some results in fuzzy metric spaces for such kind of mappings. The theorems presented provide a generalization of some interesting results in the literature. Two examples and an application to integral equations are given to illustrate the usability of our theory.

integral equationsGeneralization02 engineering and technologyFixed point01 natural sciencesFuzzy logicSettore MAT/05 - Analisi Matematica0202 electrical engineering electronic engineering information engineeringmodified α-ϕ-fuzzy contractive mappingDiscrete Mathematics and Combinatorics0101 mathematicsα-admissible mapping with respect to ηMathematicsDiscrete mathematicsbusiness.industryApplied Mathematicslcsh:MathematicsUsabilitylcsh:QA1-939Integral equationFuzzy metric space010101 applied mathematicsAlgebraintegral equationfixed point020201 artificial intelligence & image processing$alpha$-admissible mapping with respect to $eta$ fixed point modified $alpha$-$phi$-fuzzy contractive mapping integral equationsbusinessAnalysisJournal of Inequalities and Applications
researchProduct

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Havainnoidun perhevuorovaikutuksen ja koetun perheilmapiirin väliset yhteydet

1999

itsearviointivuorovaikutushavainnointiperheperheilmapiiriperhevuorovaikutus
researchProduct

Itsensä työllistäjän arjen realismi

2016

itsensä työllistäminentyöharjoitteluttyövoimapolitiikkaopiskelijatkirja-arvostelutosa-aikaisuusyksinyrittäjättyöllisyysmääräaikaisuusvuokratyöfreelanceritnollatuntisopimusedunvalvonta
researchProduct

Itseohjautuvuus organisaatiomuutoksessa

2000

itseohjautuvuusorganisaatiottyöyhteisötmuutosilmapiiri
researchProduct

Yliopistotyön kirot ja tähtihetket : kuinka kehittää hyvinvointia akateemisessa työssä?

2004

johtaminenhenkinen hyvinvointiorganisaatiokulttuurijaksaminenhenkilöstötyöyhteisötyliopistottyöilmapiirityötyytyväisyystulosohjaus
researchProduct