Search results for "Map"

showing 10 items of 3484 documents

An Ethical Perspective on Loot Box Purchasing : Examining Psychosocial Antecedents and the Association with Indebtedness

2023

Loot boxes are popular random reward mechanisms in digital games, attracting players to invest real money to enhance their gaming experiences. Loot boxes share striking similarities to gambling and might contribute to one’s economic strain, but more research is needed on the underlying vulnerabilities and motivational traits in loot box purchasing. This paper examines associations with self-reported increase in loot box purchasing and debt problems during the first year of the COVID-19 pandemic. International survey data were collected in 2021, consisting of Finnish, Swedish, and British respondents (N = 2,991) aged 18 to 75. Partial least squares modeling was used as an analytical techniqu…

resilienssiostokäyttäytyminenpsykososiaaliset tekijätkuluttajakäyttäytyminenongelmapelaaminensocial relationshipsindebtednesssosiaaliset suhteetyksinäisyyspelaajatlonelinessloot boxresilienceverkkopelit
researchProduct

Grass Pea

2011

Grass pea (Lathyrus. sativus L.) is an annual legume crop with high protein content and remarkable resistance to extreme environmental conditions, including fl ooding, drought, salinity and low soil fertility, and a signifi cant degree of resistance to biotic stress agents. It is rightly considered one of the most promising sources of calories and protein for the vast and expanding populations of drought-prone and marginal areas of Asia and Africa and as an interesting alternative for cropping systems diversifi cation in marginal lands in Europe, Australia and America. It is a dual purpose crop with great agronomic potential as a grain and forage legume. Nevertheless, as a result of the lit…

resistance[SDV] Life Sciences [q-bio][SDE] Environmental Sciencesbiotic and abiotic stressesbreedinglathyrismgenetic transformation[SDV.BV] Life Sciences [q-bio]/Vegetal Biologyexpression analysisgenome mappingODAPdiversity analysis
researchProduct

On the use of multi-temporal series of COSMO-SkyMed data for LANDcover classification and surface parameter retrieval over agricultural sites

2011

The objective of this paper is to report on the activities carried out during the first year of the Italian project “Use of COSMO-SkyMed data for LANDcover classification and surface parameters retrieval over agricultural sites” (COSMOLAND), funded by the Italian Space Agency. The project intends to contribute to the COSMO-SkyMed mission objectives in the agriculture and hydrology application domains.

retrieval algorithmsContextual image classificationbusiness.industryCOSMO-SkyMedCOSMO-SkyMed classification retrieval algorithmsClassificationData modelingStatistical classificationHydrology (agriculture)AgricultureClassification; COSMO-SkyMed; retrieval algorithmsEnvironmental scienceTerrain mappingbusinessRetrieval algorithmRemote sensing
researchProduct

Cytotoxic necrotizing factor type 2 produced by virulent Escherichia coli modifies the small GTP-binding proteins Rho involved in assembly of actin s…

1994

Cytotoxic necrotizing factor type 2 (CNF2) produced by Escherichia coli strains isolated from intestinal and extraintestinal infections is a dermonecrotic toxin of 110 kDa. We cloned the CNF2 gene from a large plasmid carried by an Escherichia coli strain isolated from a lamb with septicemia. Hydropathy analysis of the deduced amino acid sequence revealed a largely hydrophilic protein with two potential hydrophobic transmembrane domains. The N-terminal half of CNF2 showed striking homology (27% identity and 80% conserved residues) to the N-terminal portion of Pasteurella multocida toxin. Methylamine protection experiments and immunofluorescence studies suggested that CNF2 enters the cytosol…

rho GTP-Binding ProteinsBacterial ToxinsMolecular Sequence DataRestriction Mapping[SDV.BC]Life Sciences [q-bio]/Cellular BiologyBiologyIn Vitro TechniquesSEQUENCE GENIQUEmedicine.disease_causeCell LineGTP-binding protein regulatorsGTP-Binding ProteinsmedicineEscherichia coliHumansCloning MolecularCytoskeletonEscherichia coliPeptide sequence[SDV.BC] Life Sciences [q-bio]/Cellular BiologyActinAdenosine Diphosphate RiboseMultidisciplinaryBase SequenceSequence Homology Amino AcidCytotoxinsBinding proteinEscherichia coli ProteinsMolecular biologyActinsCytosolTransmembrane domainActin CytoskeletonBiochemistryGenes BacterialFACTEUR CYTOTOXIQUE NECROSANTSequence AlignmentResearch Article
researchProduct

Late Activation of Stress-activated Protein Kinases/c-Jun N-terminal Kinases Triggered by Cisplatin-induced DNA Damage in Repair-defective Cells

2011

Although stress-activated protein kinases/c-Jun N-terminal kinases (SAPK/JNK) are rapidly activated by genotoxins, the role of DNA damage in this response is not well defined. Here we show that the SEK1/MKK4-mediated dual phosphorylation of SAPK/JNK (Thr-183/Tyr-185) correlates with the level of cisplatin-DNA adducts at late times (16–24 h) after drug treatment in both human and mouse cells. Transfection of platinated plasmid DNA also caused SAPK/JNK activation. A defect in transcription-coupled nucleotide excision repair resting on a mutation in Cockayne syndrome group B protein promoted the late SAPK/JNK activation following cisplatin exposure. Signaling to SAPK/JNK was accompanied by act…

rho GTP-Binding ProteinsDNA RepairMAP Kinase Kinase 4DNA repairDNA damageDNA damage response; DNA repair; cisplatin-DNA adducts; SAPK/JNKp38 mitogen-activated protein kinasesAntineoplastic AgentsCell Cycle ProteinsAtaxia Telangiectasia Mutated ProteinsProtein Serine-Threonine KinasesDNA and ChromosomesBiologyBiochemistryAtaxia Telangiectasia Mutated ProteinsDNA AdductsMiceRadiation IonizingAnimalsHumansDNA Breaks Double-StrandedMolecular BiologyReplication protein ACells CulturedMice KnockoutKinaseTumor Suppressor ProteinsJNK Mitogen-Activated Protein KinasesCell BiologyMolecular biologyDNA-Binding ProteinsEnzyme Activationc-Jun N-terminal kinasesbiology.proteinCisplatinSignal TransductionNucleotide excision repairJournal of Biological Chemistry
researchProduct

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia
researchProduct

The potential of γ-ray spectroscopy for soil proximal survey in clayey soils Le potentiel de la spectroscopie a rayons-γ lors de l’echantillonnage pe…

2013

La spettroscopia di raggi-γ misura la distribuzione e l’intensità della radiazione gamma emessa naturalmente dai suoli o dalle rocce. I radionuclidi più importanti nel suolo come fonte di raggi gamma sono: 40K, 232Th, 238U ed 137Cs, quest’ultimo di origine artificiale, principalmente legato all’esplosione di Chernobyl o ad inquinamenti radioattivi. La distribuzione e la quantità di questi radionuclidi è strettamente dipendente dalla mineralogia del parent material e dalla capacità di scambio cationico del suolo. Scopo di questo lavoro è quello di mostrare le potenzialità di un rilevamento prossimale con spettroscopia di raggi-γ in campi sperimentali con suoli argillosi della Sicilia occiden…

rilevamento prossimale radiometria cartografia pedologica stock di carbonio agricoltura di precisioneSettore AGR/14 - Pedologiasoil proximal sensing radiometry soil mapping carbon stock precision agricultureéchantillonnage proximal radiométrie cartes des sols stock de carbone agriculture de précision
researchProduct

Risk map of transmission of urogenital schistosomiasis by Bulinus truncatus (Audouin, 1827) (Mollusca Gastropoda, Bulinidae) in Spain and Portugal

2019

Mapa del riesgo de contraer schistosomiasis urogenital provocada por Bulinus truncatus (Audouin, 1827) (Mollusca Gastropoda, Bulinidae) en España y Portugal Se da a conocer el mapa de la distribución geográfica de Bulinus truncatus en España y Portugal en el que se recopilan las localidades históricas y actuales, que coincide con el mapa del riesgo de contraer schistosomiasis urogenital provocada por este caracol de agua dulce. Se revisan las muestras de esta especie depositadas en el Museu de Ciències Naturals de Barcelona y en el Museo de Ciencias Naturales de Madrid, así como datos propios, incluidas algunas aportaciones inéditas. Este mapa permitirá conocer el área óptima de esta especi…

risk mapBulinus truncatusSchistosomiasisMol·luscosBulinus truncatus; Bulinidae; Schistosomiasis urogenital; Mapa de riesgo; España; Portugallcsh:ZoologyGastropodaspainmedicinebulinus truncatusUrogenital Schistosomiasislcsh:QL1-991MolluscaFreshwater molluscNature and Landscape ConservationSchistosoma haematobiumbiologybulinidaeBulinus truncatus; Bulinidae; Urogenital schistosomiasis; Risk map; Spain; Portugalurogenital schistosomiasismedicine.diseasebiology.organism_classificationportugalMalalties parasitàriesGeographyRisk mapAnimal Science and ZoologyHumanitiesAnimal Biodiversity and Conservation
researchProduct

Time-gated Raman and laser-induced breakdown spectroscopy in mapping of eudialyte and catapleiite

2020

Raman analysis of rock samples containing rare earth elements (REEs) is challenging due to the strong fluorescence, which may mask the weaker Raman signal. In this research, time‐gated (TG) Raman has been applied to the construction of the mineral distribution map from REE‐bearing rock. With TG Raman, material is excited with a short subnanosecond laser pulse, and the Raman signal is collected within a picosecond‐scale time window prior to the formation of a strong fluorescent signal by means of single‐photon avalanche diode array. This allows signal readout with a significantly reduced fluorescence background. TG Raman maps are used to reveal the location of valuable minerals and are compa…

rock analysisspektroskopiatime-gated RamanREE&-bearing mineralslaser-induced breakdown spectroscopy (LIBS)mineral mapping
researchProduct

Simbolu interpretācija romantisma un simbolisma perioda tēlotāja mākslā

2015

Bakalaura darba tēma ir simbolu interpretācija romantisma un simbolisma glezniecībā, balstoties uz Zigmunda Freida sapņu interpretācijas teoriju. Freida sapņu interpretāciju simbolu skaidrošanai glezniecībā ļauj izmantot Freida apgalvojums, ka mākslas darbi var tikt skaidroti tāpat kā sapņi. Balstoties uz Freida sapņu interpretācijas teoriju, tika izstrādāts interdisciplinārs pētījums, kura mērķis ir piedāvāt lasītājam izmantot šādu mākslas darbu simbolu skaidrošanas metodi un ar tās palīdzību saprast kā simbolu nozīme gleznās var ietekmēt mūsu zemapziņu. Pētījuma rezultāti rāda, ka pārsvarā visu simbolu nozīme ir reducējama uz pašām galvenākajām cilvēka dziņām: barošanos un vairošanos. Sap…

romantismsValodniecībazemapziņasapņu interpretācijasimbolismssapņi
researchProduct