Search results for "MerA"

showing 10 items of 3426 documents

DEVELOPMENT OF SUSTAINABLE METROPOLITAN AREAS USING A MULTI-SCALE DECISION SUPPORT SYSTEM

2012

A sustainable and sustaining planning strategy is globally important for metropolitan areas. Sustainable planning addresses the development of strategies to reduce the use of resources, increase economic efficiency and improve integration of social aspects. In contrast, splinter development (e.g. urban sprawl) involves damage to nature and generation of an increasing volume of traffic (these are the main criticisms following a study by Newman and Kenworthy (1989) on the relationship between settlement density and energy consumption). Interestingly, the overly compact city also has this effect as it may generate traffic flows for accessing green and leisure areas, or changes of residence due…

sustainable developmentaménagement multi-échelles[SHS.GEO] Humanities and Social Sciences/GeographyagglomerationsModélisation et visualisation spatialesvillesSpatial modeling and visualizationaccessibilityaménagement stratégiquecitiesfractals.développement durable et constructifmulti-scale decision support systemaccessibilité
researchProduct

Stratégie d'aménagement pour le développement durable d'aires métropolitaines par un système multi-scalaire d'aide à la décision : l'exemple de Vienne

2012

A sustainable and sustaining planning strategy is globally important for metropolitan areas. Sustainable planning addresses the development of strategies to reduce the use of resources, increase economic efficiency and improve integration of social aspects (e.g. pedestrian-friendly environments, well-balanced public and private transport modes, efficient street networks, land use, movement economy; access for all to jobs, retail, services; healthcare, culture and leisure). In contrast, splinter development (e.g. urban sprawl) involves damage to nature and generation of an increasing volume of traffic (these are the main criticisms following a study by Newman and Kenworthy (1989) on the rela…

sustainable developmentmodélisation et visualisation spatiales[SHS.GEO] Humanities and Social Sciences/Geographyaménagement multi-échellesagglomerationsvilles[SHS.GEO]Humanities and Social Sciences/Geographyagglomérationsaccessibility[ SHS.GEO ] Humanities and Social Sciences/Geographyspatial modeling and visualizationaménagement stratégiquesstrategic multi-scale planningcitiesdéveloppement durable et constructifaccessibilité
researchProduct

Molecular analysis of lichen-associated bacterial communities.

2006

The bacterial communities associated with 11 different lichen samples (belonging to eight different species) from different habitats were investigated. The culturable aerobic-heterotrophic fraction of the bacterial communities was isolated from nine lichen samples on protein-rich and sugar-rich/N-free media. Thirty-four bacterial isolates were purified and pooled into groups (phylotypes) by analysis of the ribosomal internal transcribed spacer polymorphism. Twenty five phylotypes were identified, each comprising between one and three isolates. One isolate of each phylotype was partially sequenced and the resulting 16S rRNA gene sequences were compared in a phylogenetic analysis. Three gener…

symbiosiSSU rDNAinternal transcribed spacer polymorphismBacteriaBase SequenceLichensbacterial communitieRNA Ribosomal 16SMolecular Sequence DatalichenPolymerase Chain ReactionPhylogenyFEMS microbiology ecology
researchProduct

Twister Tries

2015

Many commonly used data-mining techniques utilized across research fields perform poorly when used for large data sets. Sequential agglomerative hierarchical non-overlapping clustering is one technique for which the algorithms’ scaling properties prohibit clustering of a large amount of items. Besides the unfavorable time complexity of O(n 2 ), these algorithms have a space complexity of O(n 2 ), which can be reduced to O(n) if the time complexity is allowed to rise to O(n 2 log2 n). In this paper, we propose the use of locality-sensitive hashing combined with a novel data structure called twister tries to provide an approximate clustering for average linkage. Our approach requires only lin…

ta113Hierarchical agglomerative clusteringta112Fuzzy clusteringBrown clusteringComputer scienceSingle-linkage clusteringcomputer.software_genreHierarchical clusteringLocality-sensitive hashingData setCURE data clustering algorithmlocality-sensitive hashingaverage linkageData miningHierarchical clustering of networkslinear complexityCluster analysishierarchical clusteringAlgorithmcomputerTime complexityProceedings of the 2015 ACM SIGMOD International Conference on Management of Data
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

CCTV-FullyAware: toward end-to-end feasible privacy-enhancing and CCTV forensics applications

2022

It is estimated that over 1 billion Closed-Circuit Television (CCTV) cameras are operational worldwide. The advertised main benefits of CCTV cameras have always been the same; physical security, safety, and crime deterrence. The current scale and rate of deployment of CCTV cameras bring additional research and technical challenges for CCTV forensics as well, as for privacy enhancements. This paper presents the first end-to-end system for CCTV forensics and feasible privacy-enhancing applications such as exposure measurement, CCTV route recovery, CCTV-aware routing/navigation, and crowd-sourcing. For this, we developed and evaluated four complex and distinct modules (CCTVCV [1], OSRM-CCTV [2],…

tekninen rikostutkintatietosuojamachine learningkoneoppiminenyksityisyyskameravalvontaobject detectionvideo surveillancekonenäkönavigationsovellusohjelmatyksilönsuojaprivacy-enhancing technologies2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

Consensus modelling and molecular dynamics studies for the identification of novel telomerase inhibitors as anti-cancer agents

2018

Telomerase plays an important role in early stages of life-maintaing telomere and chromosomal integrity of frequently dividing cells. It turns dormant in most somatic cells during adulthood. However, in cancer cells, telomerase gets reactivated and works tirelessly to maintain the length of telomeres, leading to immortality of cells. Hence, in this study, we have used a combined ligand-based and structure based drug design approach for the identification of novel telomerase inhibitors as anti-cancer agents. We have generated ligand-based QSAR models and structure-based pharmacophores models, according our recent MYSHAPE approach (1), and validated exhaustively. The validated models were use…

telomerase inhibitors molecular modelling molecular dynamics
researchProduct

Incremento della temperatura lungo la superficie radicolare durante la tecnica dell’onda continua di condensazione

2008

INTRODUZIONE: Le temperature raggiunte degli strumenti portatori di calore, durante la condensazione a caldo della guttaperca, sono molto elevate. Ciò potrebbe rappresentare una fonte di danno iatrogeno a livello delle strutture parodontali sottoposte ad un eccessivo stress termico. SCOPO DEL LAVORO: Valutazione termografica a infrarossi dell’incremento della temperatura lungo la superficie radicolare, durante la tecnica dell’onda continua di condensazione. MATERIALI E METODI: Venti incisivi laterali mascellari, estratti per motivi parodontali, sono stati selezionati e alesati con M-two. In tutti i campioni è stata eseguita un’otturazione canalare mediante coni di guttaperca non standardizz…

temperatura radicolare onda continua termocameraSettore MED/28 - Malattie Odontostomatologiche
researchProduct

Microformas: Mi solitario vuelo (Microrrelato), La mariposa efímera (Microcuento)

2021

territorios para el arte 590908 2021 7 8182074 Microformas: Mi solitario vuelo (Microrrelato) [revista de investigación musical]Rosa 418 419UNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASrevista de investigación musical: territorios para el arte 590908 2021 7 8182074 Microformas: Mi solitario vuelo (Microrrelato)La mariposa efímera (Microcuento) Iniesta Masmano:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]2386-8260 13268 Itamar
researchProduct

Densities, Refractive Indices, and Derived Excess Properties of the Binary Systems Toluene + Isooctane and Methylcyclohexane + Isooctane and the Tern…

2000

This paper reports mesurements of the densities and refractive indices of the binary systems toluene + isooctane and methylcyclohexane + isooctane and the ternary systems tert-butyl alcohol (TBA) + toluene + isooctane and tert-butyl alcohol (TBA) + methylcyclohexane + isooctane over the entire range of composition at 298.15 K. Excess molar volumes and changes of refractive indices were evaluated from the experimental data obtained. These derived properties were fitted to variable-degree polynomials. The experimental values of physical properties were compared with the values estimated by different methods.

tert-Butyl alcoholTernary numeral systemGeneral Chemical EngineeringButanolAnalytical chemistryAlcoholGeneral ChemistryToluenechemistry.chemical_compoundMolar volumechemistryOrganic chemistryBinary systemMethylcyclohexaneJournal of Chemical & Engineering Data
researchProduct