Search results for "Meta"

showing 10 items of 21438 documents

Methods to enhance hydrolysis during one and two-stage anaerobic digestion of energy crops and crop residues

2011

solubilisaatioleachatehydrolyysiuusiutuvat energialähteetsuotopetireaktoritbiokaasuleach bed reactorsmethaneADlietepatjareaktoritCODmetaanitäyssekoitusreaktoritbioenergiaanaerobiprosessitenergy cropsenergiakasvitsolubilization
researchProduct

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A.

2007

A single transient episode of hyperammonemia induces long-lasting alterations in protein kinase A. Am J Physiol Gastrointest Liver Physiol 292: G305-G314,2007; doi:10.1152/ajpgi.00100.2006.-Hepatic encephalopathy in patients with liver disease is associated with poor prognosis. This could be due to the induction by the transient episode of hepatic encephalopathy of long-lasting alterations making patients more susceptible. We show that a single transient episode of hyperammonemia induces long-lasting alterations in signal transduction. The content of the regulatory subunit of the protein kinase dependent on cAMP (PKA-RI) is increased in erythrocytes from cirrhotic patients. This increase is…

soluble guanylate cyclaseAdultLiver CirrhosisMalemedicine.medical_specialtyCirrhosisErythrocytesPhysiologyliver cirrhosisEncephalopathyhepatic encephalopathyBiologyHepatitisLiver diseaseLiver Function TestsReference ValuesPhysiology (medical)Internal medicinemedicineAnimalsHumansHyperammonemiaRats WistarProtein kinase AHepatic encephalopathyAgedHepatologyPortacaval anastomosisMetabolic disorderErythrocyte MembraneGastroenterologyAscitesHyperammonemiaMiddle Agedmedicine.diseaseCyclic AMP-Dependent Protein KinasesRatsDisease Models AnimalEndocrinologyChronic Diseaserat modelsFemaleLiver FailureAmerican journal of physiology. Gastrointestinal and liver physiology
researchProduct

Impact of the Extraction Method on the Chemical Composition and Antioxidant Potency of Rosmarinus officinalis L. Extracts

2023

Rosmarinus officinalis L. is a dietary source that produces polyphenols as secondary metabolites. These natural compounds with potent antioxidant abilities are increasingly recommended as a supplement to inhibit oxidative stress. In the current work, we evaluated the impact of the extraction method on the chemical composition of R. officinalis extract, especially on the content of carnosic (CA) and rosmarinic (RA) acids using UPLC-MS-DAD as well as on their antioxidant potency. Four extracts of Tunisian rosemary were obtained from non-conventional extraction techniques:ultrasound-assisted extraction (UAE),supercritical extraction (SFE) and UAE and SFE combined ((UAE-SFE(I), UAE-SFE(II)). Th…

sonication<i>Rosmarinus officinalis</i> L.antioxidantUPLC-MS-DAD analysisEndocrinology Diabetes and MetabolismRosmarinus officinalis L UPLC-MS-DAD analysis antioxidant sonication supercritical extractionsupercritical extractionMolecular BiologyBiochemistry
researchProduct

Development of microfluidics for sorting of carbon nanotubes

2018

Sorting of carbon nanotubes by their chirality is the current bottleneck in the way to their broad employment based on their exceptional electronic and optical properties. Despite the extensive effort, there is no known method, which would result in really pure chirality ensembles. Previously reported sorting protocols result in enrichment rather than in sorting, alter electronic structure, and suffer from low yield. This is mostly due to the statistical approach, where the nanotubes with mixed chiralities are treated as a set. In this thesis, we propose a new sorting technique based on nanotube-by-nanotube compartmelization, characterization, and sorting in a continuously running droplet-b…

sonicationlow droplet formation frequencyspektroskopiamicrofluidicsinterfacial tensionpassive trappingTADBwater-in-oilPhysics::Fluid DynamicsSDBSerotusmenetelmätsurface tensionSpan 80rajapintailmiötcentrifugationdielectrophoresisnestefysiikkadroplet stabilitycarbon nanotubesdecanedispersiotlinkoaminenfluoresenssiultraäänilong-term stabilitypisaratlajitteludroplet-basedmikropiiritindividualizationsilinizationnear-infrared fluorescenceglass microfabricationdispersionwet etchingmetallic electrodesmikrotekniikkananoputketsorting
researchProduct

Population divergence in maternal investment and embryo energy use and allocation suggests adaptive responses to cool climates

2023

1. The thermal sensitivity of early life stages can play a fundamental role in constraining species distributions. For egg-laying ectotherms, cool temperatures often extend development time and exacerbate developmental energy cost. Despite these costs, egg laying is still observed at high latitudes and altitudes. How embryos overcome the developmental constraints posed by cool climates is crucial knowledge for explaining the persistence of oviparous species in such environments and for understanding thermal adaptation more broadly. 2. Here, we studied maternal investment and embryo energy use and allocation in wall lizards spanning altitudinal regions, as potential mechanisms that enable su…

sopeutuminenmetabolic rateliskotincubation temperaturelevinneisyysembryo retentionthyroid hormonedevelopmental rateilmastomaternal effectslämpötilacost of developmentlajitoffspring size
researchProduct

The oxidative capacity of skeletal muscle : effects of genotype, high-fat diet and physical activity

2016

sopeutuminenmitochondrial biogenesisrasvatexerciselihaksetliikuntafysiologiaadaptationhiiretruokavaliotgenotyyppiangiogenesishigh-fat dietgene expressionmetabolinen oireyhtymäfyysinen aktiivisuushapenotto
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Range expansion to novel environments : evolutionary physiology and genetics in Leptinotarsa decemlineata

2010

sopeutuminentulokaslajitkoloradonkuoriainenlevinneisyysadaptationdiapaussigeneettinen muunteluinvasive speciesdiapauseenergia-aineenvaihduntacolorado beetleinsectiside stressenergy metabolismgenetic variationvieraslajit
researchProduct

Tra naturel e surnaturel: un percorso nell’antropologia weiliana

2000

soprannaturalemetafisicanaturaSimone Weil antropologia morale metodo letturaSettore M-FIL/03 - Filosofia MoraletrascendenzaSimone Weilimmanenza
researchProduct

Equilibrium and studies on sorption of heavy metals from solutions by algae

2013

sorption kineticsalgae Palmaria palmateLangmuir isothermheavy metalsalgae Spirogyra sp.
researchProduct