Search results for "Metabolomics"

showing 6 items of 286 documents

Characterization of the metabolic profile and identification of potential therapeutic targets in advanced prostate cancer patients

2023

INTRODUCCIÓN El cáncer de próstata (CaP) representa el segundo tumor en incidencia en hombres y es la quinta causa de muerte por cáncer a nivel global. El CaP es un tumor hormono-dependiente, que requiere de la activación del receptor de andrógenos (AR) para su proliferación. Clínicamente, se caracteriza por una gran variabilidad en su evolución, progresando desde una condición indolente hasta un fenotipo agresivo que puede diseminarse y metastatizar a los nodos linfáticos y huesos. Actualmente, el diagnóstico temprano del CaP se realiza mediante la determinación sérica del antígeno prostático específico (PSA) y el examen rectal digital (DRE). Si estas pruebas dan resultados anómalos y hay …

resonancia magnética nuclearesencialidad génicacáncer de próstatatherapeutic targetbiomarkersUNESCO::CIENCIAS TECNOLÓGICASprostate cancerdianas terapéuticasmetabolomicsnuclear magnetic resonancebiomarcadoresgene essentialityUNESCO::CIENCIAS MÉDICASmetabolómica
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Sportomics: metabolomics applied to sports. The new revolution?

2019

Sportomics is the application of metabolomics in sports to investigate the metabolic effects of physical exercise on individuals, whether they are professional athletes or not. Metabolomics is one of the "omics" sciences that provide a picture of the metabolic state of a person in physiological or pathological conditions. This is achieved through the analysis of metabolites present in a biological fluid, such as saliva, blood, feces, and urine. The authors revised the recent literature concerning this topic and discussed the useful information that sportomics can provide and the limits of the current experimental settings. Furthermore, in the future, sportomics analyses could be used to pre…

sportomics metabolomics exercise physiologyHumansMetabolomicsExerciseSportsEuropean review for medical and pharmacological sciences
researchProduct

1H NMR Urinary Metabolomic Analysis in Older Adults after Hip Fracture Surgery May Provide Valuable Information for Patient Profiling : A Preliminary…

2022

In these times of precision and personalized medicine, profiling patients to identify their needs is crucial to providing the best and most cost-effective treatment. In this study, we used urine metabolomics to explore the characterization of older adults with hip fractures and to explore the forecasting of patient outcomes. Overnight urine specimens were collected from 33 patients (mean age 80 ± 8 years) after hip fracture surgery during their stay at a rehabilitation hospital. The specimens were analyzed with 1H NMR spectroscopy. We performed a metabolomics study regarding assessments of frailty status, Functional Independence Measure (FIM), and Short Physical Performance Battery (SPPB). …

suorituskykyEndocrinology Diabetes and MetabolismFIM-toimintakykymittarifyysinen toimintakykyfrailtyBiochemistrymetabolomicslonkkaleikkaushoitohip fracture; frailty; functioning; metabolomics; nuclear magnetic resonance spectroscopyfunctioningmurtumathip fractureaineenvaihduntatuotteetNMR-spektroskopiavirtsaMolecular Biologyikääntyneetnuclear magnetic resonance spectroscopy
researchProduct

Identification of omic profiles for diagnosis and monitoring of bladder cancer

2019

La presente Tesis titulada Identificación de perfiles ómicos para el diagnóstico y la monitorización del cáncer de vejiga se centra en la identificación de biomarcadores metabolómicos urinarios no invasivos para el diagnóstico y la monitorización del cáncer de vejiga (CaV). Con este fin, se han utilizado dos plataformas analíticas: la Resonancia Magnética Nuclear (Nuclear Magnetic Resonance, 1H NMR) y la Cromatografía Líquida de alta resolución acoplada a la Espectrometría de Masas (Ultraperformance Liquid Chromatography–Mass Spectrometry, UPLC-MS). Además, se han analizado tejidos vesicales mediante la técnica de Resonancia Magnética Nuclear de Alta Resolución con Giro de Ángulo Mágico (Hi…

transcriptomicsnuclear magnetic resonanceUNESCO::CIENCIAS MÉDICASbladder cancermetabolic pathways:CIENCIAS MÉDICAS [UNESCO]metabolomicsmass spectrometry
researchProduct

Inferring Phytoplankton, Terrestrial Plant and Bacteria Bulk δ¹³C Values from Compound Specific Analyses of Lipids and Fatty Acids.

2015

Stable isotope mixing models in aquatic ecology require δ13C values for food web end members such as phytoplankton and bacteria, however it is rarely possible to measure these directly. Hence there is a critical need for improved methods for estimating the δ13C ratios of phytoplankton, bacteria and terrestrial detritus from within mixed seston. We determined the δ13C values of lipids, phospholipids and biomarker fatty acids and used these to calculate isotopic differences compared to the whole-cell δ13C values for eight phytoplankton classes, five bacterial taxa, and three types of terrestrial organic matter (two trees and one grass). The lipid content was higher amongst the phytoplankton (…

ved/biology.organism_classification_rank.speciesta1172lcsh:MedicineAlgaeaquatic ecologyterrestrial plantsPhytoplanktonTerrestrial plantBotanyMetabolomics14. Life underwaterBiomasslcsh:Sciencevesiekologia2. Zero hungerBiomass (ecology)Carbon IsotopesMultidisciplinaryDetritusbiologyδ13CBacteriaved/biologyStable isotope ratioSestonFatty Acidsfungilcsh:R15. Life on landbiology.organism_classificationLipidsbacteria bulk13. Climate actionEnvironmental chemistryPhytoplanktonphytoplanktonta1181lcsh:QBiomarkersResearch ArticlePLoS ONE
researchProduct