Search results for "Muscle mass"

showing 10 items of 87 documents

Association between masticatory ability and oral functions.

2020

Background Mastication is the process of breaking ingested food with the teeth and mixing it with saliva to form a mass that is easy to swallow. However, few studies have reported on oral functions, such as occlusal force, tongue pressure, and mastication. The purpose of this study was to evaluate the association between masticatory function and oral functions, such as occlusal force and tongue pressure. Material and Methods In this study, there were 113 patients (41 men and 72 women; mean age, 68.4 ± 11.3 years) who visited dentists at the Hiroshima University Hospital, Hiroshima, Japan between April 2015 and November 2018. Masticatory function of the patients was evaluated using a mastica…

OrthodonticsOral Medicine and Pathologybusiness.industryResearch:CIENCIAS MÉDICAS [UNESCO]Muscle massOral cavityUniversity hospitalMasticatory forceTongue pressureOral functionUNESCO::CIENCIAS MÉDICASOcclusionMedicinebusinessGeneral DentistryMasticationJournal of clinical and experimental dentistry
researchProduct

Beyond Physical Exercise: The Role of Nutrition, Gut Microbiota and Nutraceutical Supplementation in Reducing Age-related Sarcopenia

2021

Sarcopenia is a commonly prevalent geriatric condition mainly characterized by progressive loss of the skeletal muscle mass that results in noticeably reduced muscle strength and quality. Most of the geriatric population above 60 years of age are overweight, leading to the accumulation of fat in the muscles resulting in abated muscle function. The increased loss of muscle mass is associated with high rates of disability, poor motility, frailty and mortality. The excessive degeneration of muscles is now also being observed in middle-aged people. Therefore, geriatrics has recently started shifting towards the identification of early stages of the disability in order to expand the life span o…

Pulmonary and Respiratory MedicineGerontologySarcopeniamedicine.medical_specialtySettore MED/09 - Medicina InternaNutritional Supplementationmuscle maNutritional StatusPhysical exercisemalnutritionOverweightGut floracachexiaCachexiamedicineHumansMuscle StrengthMuscle SkeletalNutritionAgedGeriatricsbiologyexercisebusiness.industryMuscle massMiddle Agedmedicine.diseasebiology.organism_classificationGastrointestinal MicrobiomeMalnutritionAgeingSarcopeniaDietary SupplementsPediatrics Perinatology and Child Healthmedicine.symptombusinessnutrition.
researchProduct

Appendicular Muscle Mass, Thigh Intermuscular Fat Infiltration, and Risk of Fall in Postmenopausal Osteoporotic Elder Women

2020

<b><i>Background:</i></b> The association between the quantity and composition of skeletal muscle and the decline in physical function in elderly is poorly understood. Therefore, the primary aim of this cross-over study was to investigate the association between thigh intermuscular adipose tissue (IMAT) infiltration, appendicular muscle mass, and risk of fall in postmenopausal osteoporotic elder women. Second, we examined the differences in muscle mass, IMAT, and risk of fall in the same sample of older subjects after being classified as sarcopenic or nonsarcopenic on the basis of the dual-energy X-ray absorptiometry (DXA)-based Appendicular Skeletal Muscle Mass Inde…

SarcopeniaAgingmedicine.medical_specialtyUrologyAdipose tissueRisk of fallThighMuscle massMagnetic resonance imagingAbsorptiometry PhotonmedicineHumansMuscle SkeletalDual-energy X-ray absorptiometryAgedCross-Over Studiesmedicine.diagnostic_testDual-energy X-ray absorptiometrybusiness.industryRisk of fallSkeletal musclemedicine.diseaseIntermuscular fatPostmenopauseCross-Sectional Studiesmedicine.anatomical_structureThighSarcopeniaBody CompositionMuscleAccidental FallsFemaleGeriatrics and GerontologybusinessGerontology
researchProduct

Anthropometry and body composition of young soccer players

2022

Background: Body composition and other anthropometric measurements are important factors influencing the overall performance of an athlete. Together with motor coordination, physical fitness, physical, functional, and psychosocial conditions, as well as learned technique and tactics, a player's sports potential and probability of success can be determined. Aim of the study: Our study aimed to describe anthropometric variables and body composition of young soccer players of various ages. Materials and methods: A cross-sectional study was carried out among 61 young soccer players in the under-15, under-16, and under-19 categories. We used a bioimpedance analyzer to measure the following indic…

body compositionmuscle massyoung soccer playersfat massMedical Science Pulse
researchProduct

Sarcopenia and appendicular muscle mass as predictors of impaired fasting glucose/type 2 diabetes in elderly women

2021

Elderly women exhibit a high risk of type 2 diabetes (T2D), but no definitive data exist about the possible role of postmenopausal increases in visceral adiposity, the loss of lean body mass, or decreases in the sum of the lean mass of arms and legs (appendicular skeletal muscle mass (ASMM)). This retrospective, longitudinal study investigated whether body composition (bioelectrical impedance analysis) predicted the development of impaired fasting glucose (IFG) or T2D in a cohort of 159 elderly women (age: 71 ± 5 years, follow-up: 94 months) from southern Italy (Clinical Nutrition and Geriatric Units of the “Mater Domini” University Hospital in Catanzaro, Calabria region, and the “P. Giacco…

endocrine system diseasesappendicular skeletal muscle mass.Type 2 diabetes030204 cardiovascular system & hematologyBody Mass IndexCohort StudiesEating0302 clinical medicineTX341-641Longitudinal StudiesSettore MED/49 - Scienze Tecniche Dietetiche ApplicateSicilyNutrition and DieteticsHand StrengthdiabetesFastingaging; appendicular skeletal muscle mass; body composition; diabetes; nutrition; sarcopenianutritionItalydiabetes; aging; nutrition; body composition; sarcopenia; appendicular skeletal muscle mass.FemaleBioelectrical impedance analysisappendicular skeletal muscle massmedicine.medical_specialtyWaist030209 endocrinology & metabolismClinical nutritionArticlesarcopenia03 medical and health sciencesMuscular DiseasesDiabetes mellitusInternal medicinemedicineHumansMuscle StrengthMuscle SkeletalAgedRetrospective Studiesbody compositionNutrition. Foods and food supplybusiness.industryagingnutritional and metabolic diseasesImpaired fasting glucosemedicine.diseaseGlucoseDiabetes Mellitus Type 2diabeteSarcopeniaLean body massbusinessFood Science
researchProduct

Estradiol deficiency and skeletal muscle apoptosis: Possible contribution of microRNAs.

2020

Background Menopause leads to estradiol (E2) deficiency that is associated with decreases in muscle mass and strength. Here we studied the effect of E2 deficiency on miR-signaling that targets apoptotic pathways. Methods C57BL6 mice were divided into control (normal estrous cycle, n = 8), OVX (E2 deficiency, n = 7) and OVX + E2 groups (E2-pellet, n = 4). Six weeks following the OVX surgery, mice were sacrificed and RNA isolated from gastrocnemius muscles. miR-profiles were studied with Next-generation sequencing (NGS) and candidate miRs verified using qPCR. The target proteins of the miRs were found using in silico analysis and measured at mRNA (qPCR) and protein levels (Western blot). Resu…

estrogeenit0301 basic medicineestradioliAgingmedicine.medical_specialtyvaihdevuodetcaspasemenopauseApoptosisBiochemistryArticlehormonaaliset tekijät03 medical and health sciencesMicecytochrome C0302 clinical medicineEndocrinologyWestern blotInternal medicinemicroRNAGeneticsmedicineAnimalsMuscle SkeletalMolecular BiologyCaspaseEstrous cycleMessenger RNAmedicine.diagnostic_testbiologyEstradiolsytokromitRNASkeletal muscleCell BiologyMice Inbred C57BLMicroRNAsovariectomy030104 developmental biologyEndocrinologymedicine.anatomical_structuremuscle masslihasmassaApoptosisbiology.proteinFemalemikro-RNAhormones hormone substitutes and hormone antagonists030217 neurology & neurosurgeryExperimental gerontology
researchProduct

Data from Estrogenic Regulation of Muscle Apoptosis (ERMA) study

2022

The multidisciplinary Estrogenic Regulation of Muscle Apoptosis (ERMA) study was designed to reveal how hormonal differences over the menopausal stages affect the physiological and psychological functioning of middle-aged women. In addition, health behaviour (e.g., physical activity and eating behaviour) and blood-based biomarkers are investigated. Biomarker data includes different omics datasets (e.g. metabolomics, genomics, transcriptomics). The complete data set includes baseline data collection and two different follow-ups. The baseline ERMA study (=parent data) is a population-based cohort study, which forms a parent data set for the follow-up studies (ERMA follow-up and EsmiRs). Data …

estrogeenithenkinen hyvinvointimuscle massvaihdevuodetlihasmassahealth behaviourterveyskäyttäytyminenmuscle strengthmenopausemental well-beingestrogenslihasvoima
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Strength Training Improves Metabolic Health Markers in Older Individual Regardless of Training Frequency

2019

insulinexercisekuntoliikuntamonocyte chemoattractant protein-1fat masselderlyverensokerimuscle massinflammationblood glucosevoimaharjoitteluta315ikääntyneetrasva-arvotkehonkoostumusFrontiers in Physiology
researchProduct

Strength Training Improves Metabolic Health Markers in Older Individual Regardless of Training Frequency

2019

The main purpose of the present study was to investigate the effect of frequency, thereby increasing training volume, of resistance training on body composition, inflammation markers, lipid and glycemic profile in healthy older individuals (age range 65-75 year). Ninety-two healthy participants were randomly assigned to one of four groups; performing strength training one- (EX1), two- (EX2), or three- (EX3) times-per-week and a non-training control (CON) group. Whole-body strength training was performed using 2-5 sets and 4-12 repetitions per exercise and 7-9 exercises per session. All training groups attended supervised resistance training for 6 months. Body composition was measured by dua…

insulinexercisetulehdusPhysiologykuntoliikuntamonocyte chemoattractant protein-1vanhuksetfat massinsuliiniHälsovetenskaperelderlymuscle massverensokerilihasmassainflammationHealth Sciencesblood glucosevoimaharjoitteluikääntyneetrasva-arvotOriginal Researchkehonkoostumus
researchProduct