Search results for "N'"

showing 10 items of 2398 documents

Role of multidetector-CT enteroclysis (MSCT-E) in complications of advanced Crohn's disease (CD) patients

2007

multidetector-CT enteroclysisCrohn's disease
researchProduct

Wharton’s Jelly Mesenchymal Stem Cells from Preterm Umbilical Cords: Isolation, Characterization and Potential Use as Extrahepatic Progenitors

2014

multipotent progenitor cellcell differentiationhepatogenic differentiationSettore BIO/16 - Anatomia Umanaumbilical cordwharton's jellyregenerative medicinephenotypic characteristicmesenchymal stem cell
researchProduct

Infliximab, azathioprine or combination therapy in the treatment of active Crohn's disease.

2010

The treatment of moderate-to-severe steroid-dependent Crohn's disease has been a challenging issue for the gastroenterologist. Until to 10 years ago, immunosuppressors, mainly azathioprine or 6-mercaptopurine, were the best possible treatments available, and remission rates ranged from 30 to 60% according to the results of open studies and controlled trials. Recently, infliximab has been shown to be effective in steroid-dependent patients and, combined with azathioprine, it has been shown to increase 1-year remission rates. A recent large randomized controlled trial comparing infliximab, azathioprine and infliximab plus azathioprine demonstrated that the combination of infliximab plus azath…

musculoskeletal diseasesCrohn's diseasemedicine.medical_specialtySettore MED/09 - Medicina InternaHepatologyCombination therapybusiness.industryGastroenterologyAzathioprinemedicine.diseaseGastroenterologyInfliximablaw.inventionSurgeryRandomized controlled triallawInternal medicinemedicineInfliximab azathioprine Crohnbusinessmedicine.drug
researchProduct

The role of innate and lymphoid IL-22-producing cells in the immunopathology of primary Sjögren's syndrome

2014

In primary Sjögren's syndrome (pSS) a complex of interconnections between epithelial barrier, innate and adaptive immunity occurs. IL-22 is a pleiotropic cytokine that in pSS may be placed at the intersection of the adaptive and innate branches of immunity. Some evidence suggests that, in pSS, IL-22 may play a prominent pro-inflammatory role driving the early phase of tissue and systemic inflammation and participating in the self-perpetuation of disease. Despite contradictory data in literature about the role of NK cells in pSS, recent data also suggest an important contribution of this subset of cells of the innate immune system in the development and perpetuation of inflammation. Here, we…

musculoskeletal diseasesImmunologyInflammationAdaptive ImmunitySystemic inflammationInterleukin 22stomatognathic systemImmunityImmunopathologymedicineHumansImmunology and AllergyInnateKiller CellInnate immune systembusiness.industryInterleukinsInnate lymphoid cellImmunityInterleukinAcquired immune systemeye diseasesImmunity InnateKiller Cells Naturalstomatognathic diseasesSjogren's SyndromeImmunologyNaturalmedicine.symptombusinessHuman
researchProduct

Anti-TNF-Antikörper zur Therapie von entzündlichen Darmstenosen bei Morbus Crohn

2003

Stenoses are a frequent complication in patients with Crohn's disease and represent a major diagnostic and therapeutic challenge. The proper assessment of the nature of a stenosis as inflammatory or fibrotic is critical for appropriate treatment, since symptomatic fibrotic stenoses require surgical resection. Standard diagnostic procedures to assess the nature of a stenosis include endoscopy, conventional contrast radiography and magnetic resonance tomography. Recent data suggest, that the positron-emission-tomography possesses a high sensitivity and specificity to confirm inflammatory activity in the bowel. The recombinant monoclonal anti-TNF-antibody Infliximab (Remicade) has been approve…

musculoskeletal diseasesmedicine.medical_specialtyCrohn's diseasemedicine.diagnostic_testbusiness.industryGastroenterologyColonoscopyRetrospective cohort studymedicine.diseaseGastroenterologyAsymptomaticInfliximabSurgerystomatognathic diseasesStenosisInternal medicinemedicinemedicine.symptombusinessComplicationAbscessmedicine.drugZeitschrift für Gastroenterologie
researchProduct

Emergence of severe spondyloarthropathy-related entheseal pathology following successful vedolizumab therapy for inflammatory bowel disease

2018

Objectives Vedolizumab (VDZ) blocks α4β7 integrin and is licenced for the treatment of IBD. It has been associated with mild SpA-related features, including sacroiliitis and synovitis. Herein we report a series of cases demonstrating the emergence of severe SpA-associated enthesitis/osteitis following successful IBD therapy with VDZ. Methods We evaluated 11 VDZ-treated patients with IBD across seven centres who developed severe active SpA and/or enthesopathy, with the aim of characterizing the VDZ-associated SpA or entheseal flares. Imaging features demonstrating particularly severe disease were recorded. Results De novo SpA developed in 9 of 11 patients and flare of known SpA in 2 patients…

musculoskeletal diseasesvedolizumabmedicine.medical_specialtySpondyloarthropathyenthesitimucosal vascular addressin cell adhesion molecule-1 (MADCAM-1)Vedolizumabulcerative coliti03 medical and health sciences0302 clinical medicineRheumatologyInternal medicinemedicinePharmacology (medical)030212 general & internal medicinespondyloarthritiα4β7 integrin030203 arthritis & rheumatologyCrohn's diseaseAnkylosing spondylitisbusiness.industryEnthesopathySacroiliitisEnthesitismedicine.diseaseankylosing spondylitispondylarthritiCrohn’Osteitismedicine.symptombusinessaxial SpAmedicine.drug
researchProduct

A Finnish socialist female parliamentarian stopped on the Dutch border

2020

A Finnish socialist female parliamentarian stopped on the Dutch border: the (de) politicization of Finnish women’s suffrage in Dutch battles on votes for women This research article in transnational history analyses an incident during which Hilja Pärssinen, a Finnish socialist woman MP, was stopped on the Dutch border in September 1913 on her way to visit a suffragette college in London. This two-hour event at the border and public controversy that followed were clashes between competing ideological and gendered discourses on women’s political agency. The incident was a nexus of intersecting discourses on a range of issues: Dutch and international debates on women’s suffrage, discourse on ‘…

naisetHistorymedia_common.quotation_subjectSuffrageAlankomaatWorld historyhistoriapoliittinen historiaWomen's suffragePoliticsPolitical scienceSuomiwomen’s suffragetransnationaalisuuspoliittiset oikeudetPärssinen HiljaFinlandClass conflictmedia_commontransnational historyThe NetherlandsGender studiesnaishistoriasocialist internationalismnaisen asemaSocialismIdeologyäänioikeusWhite slaveryTijdschrift voor Geschiedenis
researchProduct

Bringing madness home : the multiple meanings of home in Janet Frame's Faces in the water, Bessie Head's A question of power and Lauren Slater's Proz…

2012

naisetkirjallisuusomaelämäkerrallisuusliteraturekotiaiheethomespacepsychiatrymielenterveyspsykiatrinen hoitomielenterveyshäiriötgenderhulluuswomen's madnessbelongingFeministinen kirjallisuudentutkimus
researchProduct

From being ignored to engaging in dialogue : Young boys' narratives of children's participation in child–parent conflicts

2023

This paper examines children's opportunities to participate in everyday child–parent conflicts as revealed in young boys' fictional narratives. The data were collected from 19 boys aged 3–6 years using the Story Magician's Play Time method. Narrative analysis yielded four story types: ignored participation stories, parent-directed participation stories, child-directed participation stories and dialogical participation stories. The study illustrates that when considering children's participation in child–parent conflicts, differences between children in their opportunities to participate in resolving conflicts should be taken into account. The boys' stories draw attention to the importance o…

narrativechildren's influencevanhemmatvuorovaikutusyoung boychild-parent conflictschildren's participationlapset (ikäryhmät)konfliktitlapset (perheenjäsenet)osallistuminen
researchProduct

The mid-nineteenth-century female reality and ideals in the USA in Maria Susanna Cummins's The lamplighter

1999

nineteenth-century USAcult of domesticitywomen's historywomen's literaturecult of true womanhoodCummins Maria Susanna
researchProduct