Search results for "NET"

showing 10 items of 55461 documents

Multiscale model approach for magnetization dynamics simulations

2016

Simulations of magnetization dynamics in a multiscale environment enable the rapid evaluation of the Landau-Lifshitz-Gilbert equation in a mesoscopic sample with nanoscopic accuracy in areas where such accuracy is required. We have developed a multiscale magnetization dynamics simulation approach that can be applied to large systems with spin structures that vary locally on small length scales. To implement this, the conventional micromagnetic simulation framework has been expanded to include a multiscale solving routine. The software selectively simulates different regions of a ferromagnetic sample according to the spin structures located within in order to employ a suitable discretization…

010302 applied physicsPhysicsMesoscopic physicsMagnetization dynamicsCondensed Matter - Mesoscale and Nanoscale PhysicsScale (ratio)DiscretizationAttenuationFOS: Physical sciencesComputational Physics (physics.comp-ph)01 natural sciencesSpin waveMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesStatistical physics010306 general physicsPhysics - Computational PhysicsNanoscopic scaleSpin-½Physical Review B
researchProduct

Calculation of the electrostatic field in a dielectric-loaded waveguide due to an arbitrary charge distribution on the dielectric layer

2016

The goal of this paper is to study the electrostatic field due to an arbitrary charge distribution on a dielectric layer in a dielectric-loaded rectangular waveguide. In order to obtain this electrostatic field, the potential due to a point charge on the dielectric layer is solved in advance. The high computational complexity of this problem requires the use of different numerical integration techniques (e.g., Filon, Gauss-Kronrod, Lobatto, …) and interpolation methods. Using the principle of superposition, the potential due to an arbitrary charge distribution on a dielectric layer is obtained by adding the individual contribution of each point charge. Finally, a numerical differentiation o…

010302 applied physicsPhysicsMultipactor effectPoint particlePhysics::OpticsCharge density020206 networking & telecommunications02 engineering and technologyDielectricElectrostatics01 natural sciencesComputational physicsElectric field0103 physical sciences0202 electrical engineering electronic engineering information engineeringDouble layer potentialElectric potential2016 Progress in Electromagnetic Research Symposium (PIERS)
researchProduct

Piezo-electrical control of gyration dynamics of magnetic vortices

2019

In this work, we first statically image the electrically controlled magnetostatic configuration of magnetic vortex states and then we dynamically image the time-resolved vortex core gyration tuned by electric fields. We demonstrate the manipulation of the vortex core gyration orbit by engineering the magnetic anisotropies. We achieve this by electric fields in a synthetic heterostructure consisting of a piezoelement coupled with magnetostrictive microstructures, where the magnetic anisotropy can be controlled by strain. We directly show the strong impact of the tailored anisotropy on the static shape of the vortex state and the dynamic vortex core orbit. The results demonstrate the possibil…

010302 applied physicsPhysicsPhysics and Astronomy (miscellaneous)Condensed matter physicsMagnetostriction02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesGyrationVortex stateVortexCondensed Matter::Materials ScienceMagnetic anisotropyCondensed Matter::SuperconductivityElectric field0103 physical sciencesOrbit (dynamics)0210 nano-technologyAnisotropyApplied Physics Letters
researchProduct

Current induced chiral domain wall motion in CuIr/CoFeB/MgO thin films with strong higher order spin–orbit torques

2020

We investigate the Dzyaloshinskii–Moriya interaction (DMI) and spin–orbit torque effects in CuIr/CoFeB/MgO heterostructures. To this end, harmonic Hall measurements and current induced domain wall motion experiments are performed. The motion of domain walls at zero applied field due to current demonstrates the presence of DMI in this system. We determine the strength of the DMI to be D = + 5 ± 3 μ J / m 2 and deduce right-handed chirality in domain walls showing a partial Neel type spin structure. To ascertain the torques, we perform a second harmonic measurement to quantify the damping- and field-like current induced effective fields as a function of the magnetization direction. From the a…

010302 applied physicsPhysicsPhysics and Astronomy (miscellaneous)Condensed matter physicsSpinsField (physics)02 engineering and technologySpin structure021001 nanoscience & nanotechnology01 natural sciencesMagnetizationDomain wall (magnetism)0103 physical sciencesDomain (ring theory)HarmonicCondensed Matter::Strongly Correlated Electrons0210 nano-technologySpin-½Applied Physics Letters
researchProduct

Erratum: “Concentric transmon qubit featuring fast tunability and an anisotropic magnetic dipole moment” [Appl. Phys. Lett. 108, 032601 (2016)]

2018

010302 applied physicsPhysicsPhysics and Astronomy (miscellaneous)Magnetic momentCondensed matter physics02 engineering and technologyTransmonConcentric021001 nanoscience & nanotechnology01 natural sciencesMagnetic anisotropyQubit0103 physical sciences0210 nano-technologyAnisotropyQuantum computerApplied Physics Letters
researchProduct

System for control of polarization state of light and generation of light with continuously rotating linear polarization

2019

We present a technique for generating light in an arbitrary polarization state. The technique is based on interference of two orthogonally polarized light beams, whose amplitudes and phases are controlled with a Mach-Zehnder inteferometer with acousto-optic modulators (AOMs) placed in each arm. We demonstrate that via control over amplitudes, phases, and frequencies of acoustic waves driving the AOMs, any polarization state can be synthesized. In particular, we demonstrate generation of linearly polarized light, whose polarization plane continuously rotates at a rate from 1 kHz to 1 MHz. Such light finds applications in science (e.g., investigations of Bloch-Siegert effect) and technology (…

010302 applied physicsPhysicsPolarization planebusiness.industryLinear polarizationMagnetometerLinearly polarized lightFOS: Physical sciencesAcoustic wavePhysics - Applied PhysicsApplied Physics (physics.app-ph)Polarization (waves)01 natural sciences010305 fluids & plasmaslaw.inventionAmplitudeOpticslaw0103 physical sciencesOptical rotationbusinessInstrumentationPhysics - OpticsOptics (physics.optics)
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Analytical induced force solution in conducting cylindrical bodies and rings due to a rotating finite permanent magnet

2020

Abstract Using exact expression of the magnetic field we derive analytical expression for the induced current density and volume force in a solid conducting cylinder and ring due to a coaxial rotating finite permanent magnet with transverse magnetization. The integral torque is calculated from these expressions and validated with numerical and experimental results. Conditions for useful magnetic field approximations are found.

010302 applied physicsPhysicsRing (mathematics)02 engineering and technologyMechanics021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldMagnet0103 physical sciencesCylinderTorqueCoaxial0210 nano-technologyAxial symmetryCurrent densityJournal of Magnetism and Magnetic Materials
researchProduct

2019

We present a design for producing precisely adjustable and alternating single-axis magnetic fields based on nested Halbach dipole pairs consisting of permanent magnets only. Our design allows for three dimensional optical and mechanical access to a region with strong adjustable dipolar fields, is compatible with systems operating under vacuum, and does not effectively dissipate heat under normal operational conditions. We present a theoretical analysis of the properties and capabilities of our design and construct a proof-of-concept prototype. Using our prototype, we demonstrate fields of up to several kilogauss with field homogeneities of better than 5%, which are harmonically modulated at…

010302 applied physicsPhysicsScale (ratio)Field (physics)AcousticsPolarimetryGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMagnetic fieldGenerator (circuit theory)DipoleMagnet0103 physical sciences0210 nano-technologyVariable (mathematics)AIP Advances
researchProduct