Search results for "NOE"

showing 10 items of 825 documents

Effectiveness of low flow vascular lesions sclerosis with monoetanolamine: Report of six cases

2007

Vascular malformations or even hemangiomas need therapeutic intervention if they start to cause clinical symptoms or personal discomfort. Different therapeutic modalities, including cryotherapy, corticosteroids, laser therapy, sclerotherapy, surgery, and/or embolization, can be performed successfully. Sclerotherapy with monoethanolamine is a relatively simple and effective method to treat low flow vascular lesions. We presented a report of six cases of vascular malformations treated with monoethanolamine. There were 3 male and 3 female patients, with an age range of 20 to 68 years. The patients were submitted to applications according to clinical response and/or tolerability. In all cases, …

hemangiomaUNESCO::CIENCIAS MÉDICASVascular lesionssclerotherapymonoethanolamine:CIENCIAS MÉDICAS [UNESCO]
researchProduct

Structural and Electrochemical Analysis of CIGS: Cr Crystalline Nanopowders and Thin Films Deposited onto ITO Substrates

2021

A new approach for the synthesis of nanopowders and thin films of CuInGaSe2 (CIGS) chalcopyrite material doped with different amounts of Cr is presented. The chalcopyrite material CuInxGa1 − xSe2 was doped using Cr to form a new doped chalcopyrite with the structure CuInxCryGa1 − x − ySe2, where x = 0.4 and y = 0.0, 0.1, 0.2, or 0.3. The electrical properties of CuInx CryGa1 − x − ySe2 are highly dependent on the Cr content and results show these materials as promising dopants for the fabrication thin film solar cells. The CIGS nano-precursor powder was initially synthesized via an autoclave method, and then converted into thin films over transparent substrates. Both crystalline precursor p…

hydrothermalMaterials scienceGeneral Chemical Engineeringchalcopyrite compounds02 engineering and technology010402 general chemistry01 natural sciencesArticlenanocrystalsspin coatingGeneral Materials ScienceThin filmQD1-999Cèl·lules fotoelèctriquesSpin coatingEISDopantChalcopyriteDoping021001 nanoscience & nanotechnologyCopper indium gallium selenide solar cells0104 chemical sciencesDielectric spectroscopyElectroquímicaChemistryNanocrystalChemical engineeringvisual_artvisual_art.visual_art_mediumconductivityMaterials nanoestructurats0210 nano-technology
researchProduct

Neurocognitive Markers During Prolonged Breath-Holding in Freedivers: An Event-Related EEG Study

2019

Since little is known concerning the psychological, cognitive, and neurophysiological factors that are involved in and important for phases of prolonged breath-holding (pBH) in freedivers, the present study uses electroencephalography (EEG) to investigate event-related neurocognitive markers during pBH of experienced freedivers that regularly train pBH. The purpose was to determine whether the well-known neurophysiological modulations elicited by hypoxic and hypercapnic conditions can also be detected during pBH induced hypoxic hypercapnia. Ten experienced free-divers (all male, aged 35.10 ± 7.89 years) were asked to hold their breath twice for 4 min per instance. During the first pBH, a ch…

hypoxemiaPhysiologyPhysiology (medical)150 Psychologiehypercapniaapnoea divingP300150 PsychologyVEPERPelectroencephalographyOriginal ResearchFrontiers in Physiology
researchProduct

Rezonanses metode nanoelektromehāniska slēdža ieslēgšanas sprieguma samazināšanai

2018

Nanoelektromehāniskajiem (NEM) slēdžiem ir potenciāls aizstāt mikroelektromehāniskos (MEM) slēdžus. Tomēr pirms tas ir iespējams, jāpārvar ar NEM slēdža darbību saistītas problēmas, piemēram, lielais ieslēgšanās spriegums, kas ne tikai ierobežo NEM slēdžu integrāciju elektriskajās shēmās, bet arī var izraisīt slēdža aktīvās komponentes pārdegšanu un neatgriezenisku palikšanu kontaktā. Šajā darbā tika izstrādāta metodika efektīvākai nanovadu pārnešanai uz adatas smailā gala. Tika nomērītas NEM slēdžu aktīvo elementu mehāniskās īpašības - noteikti Ge un CuO nanovadu Junga moduļi. Tika teorētiski izpētīta un eksperimentāli demonstrēta NEM slēdža ieslēgšanās elektrostatiskajā laukā, noteikti ie…

ieslēgšanās spriegumsFizikananoelektromehāniskais slēdzisnoliecerezonanse
researchProduct

Focusing on Ciona intestinalis (Tunicata) innate immune system. Evolutionary implications

2009

Phylogenetic analyses based on molecular data provide compelling evidence that ascidians are of critical importance for studying chordate immune system evolution. The Ciona intestinalis draft genome sequence allows searches for phylogenetic relationships, gene cloning and expression of immunorelevant molecules. Acidians lack of the pivotal components of the vertebrate recombinatory adaptive immunity, i.e., MHC, TCRs and dimeric immunoglobulins. However, bioinformatic sequence analyses recognized genic elements indicating the essential features of the Ig superfamily and ancestor proto-MHC genes, suggesting a primitive pre-duplication and pre-recombination status. C. intestinalis genes for in…

immunoevolutionascidianslcsh:Biology (General)gene expressionchemical and pharmacologic phenomenainflammatory responseCiona intestinalis immunitygenomeinnate immunitylcsh:QH301-705.5Ciona intestinalisInvertebrate Survival Journal
researchProduct

Effects of B-Cell Lymphoma on the Immune System and Immune Recovery after Treatment: The Paradigm of Targeted Therapy

2022

B-cell lymphoma and lymphoproliferative diseases represent a heterogeneous and complex group of neoplasms that are accompanied by a broad range of immune regulatory disorder phenotypes. Clinical features of autoimmunity, hyperinflammation, immunodeficiency and infection can variously dominate, depending on the immune pathway most involved. Immunological imbalance can play a role in lymphomagenesis, also supporting the progression of the disease, while on the other hand, lymphoma acts on the immune system to weaken immunosurveillance and facilitate immunoevasion. Therefore, the modulation of immunity can have a profound effect on disease progression or resolution, which makes the immune syst…

immunosenescenceLymphoma B-CellimmunosuppressionLymphomaB-cell lymphomaOrganic ChemistryGeneral Medicineimmune recoverychemotherapytargeted therapyImmunotherapy AdoptiveLymphoproliferative DisordersCatalysisComputer Science ApplicationsCAR-TSettore MED/15 - Malattie Del SangueInorganic ChemistryImmune Systemimmune therapyTumor MicroenvironmentimmunoevasionHumansPhysical and Theoretical ChemistryMolecular BiologySpectroscopy
researchProduct

The Nanoeconomics of Firm‐Level Decision‐Making and Industry Evolution : Evidence from 200 Years of Paper and Pulp Making

2020

Research summary We explore the qualitative differences in entries and exits over time. Using qualitative and quantitative data on 96 firms over 200 years, we study industry evolution from the perspective of individual decision‐making situations. Our historical and statistical analyses reveal the vital role of technology investments in determining firm outcomes, and the technological, institutional and governance dynamics that lead firms to invest or to abstain. Our main theoretical and methodological contribution concerns the importance of the multiplicity of firm‐level rationalities and decisions as fundamentals in theorizing on industry evolution. Managerial summary What determines firm …

industry evolutiontechnology investmentnanoeconomicsteknologiateknologinen kehitystaloushistoriaexit modemassa- ja paperiteollisuusinvestoinnitpaper and pulp industry
researchProduct

Nanovadu mehānisko īpašību izpēte un to pielietojumi nanoelektromehāniskās sistēmās

2015

Darbā noteikti monokristālisku Sb2S3, Ge un BeO nanovadu Junga moduļi. Nanovadu šķērsgriezuma laukums noteikts robežās no 7.1⋅102 nm2 līdz 7.8⋅104 nm2, garums no 3,1 µm līdz 136 µm. Mērījumi veikti skenējošā elektronu mikroskopā. Izmantotas atšķirīgas mehānisko īpašību noteikšanas metodes – elektriskā lauka ierosināta mehāniskā rezonanse, nanovadu lieces un spiedes deformācijas – un secināts, ka iegūtie rezultāti kļūdu robežās sakrīt. Eksperimentāli noteiktās Junga moduļa vērtības – 36 ± 9 GPa, 135 ± 40 GPa un 97 ± 24 GPa attiecīgi Sb2S3, Ge un BeO nanovadiem. Pētīts ar dabīgo oksīdu klātu Ge nanovadu pielietojums nanoelektromehāniskā slēdzī. Parādīts, kā adhēzija starp aktīvo elementu un e…

kontakta īpašībasFizikananovadiJunga modulisnanoelektromehāniskās sistēmas
researchProduct

Developments in many-body theory of quantum transport and spectroscopy with non-equilibrium Green's functions and time-dependent density functional t…

2015

The problem of quantum dynamics in open systems has gained attention in recent decades and not the least due to the advances made in quantum transport in molecular systems. The main motivation behind quantum transport and molecular electronics is the futuristic goal to be able at some point to replace, or to complement, the silicon-based technology and to make the electronic devices faster. On a fundamental level, one has to deal with time-dependent processes where electron-electron or electron- phonon interactions are of great importance, and they can cause profound quantitative and qualitative changes on the physical and dynamical properties of electronic systems compared to the non-inter…

kvanttikuljetuselektronikorrelaationanoelektroniikkatiheysfunktionaaliteoriamonen kappaleen häiriöteoriaGreenin funktiokvanttikemiakvanttimekaniikkakvanttifysiikkamolekyylielektroniikkaelektronittiheysmatriisirenormalisaatioryhmädynamiikka
researchProduct

Virtualitāte un laiktēls: Žila Delēza kinoestētika

2015

Maģistra darbā tiek aplūkota Žila Delēza kinoestētika caur diviem savstarpēji saistītiem jēdzieniem - virtualitāti un laiktēlu, atklājot to struktūru un kontekstualizējot attiecībā pret kinoestētiku, tādējādi skaidrojot laika nozīmes pieagumu modernajā kino. Laicisko attiecību, laiciskuma problemātikas un laika tēmas risinājums Delēza kinoestētikā ilustrēts ar piemēriem no kinofilmām, reizē pievēršot uzmanību kino tehnisko aspektu ietekmei uz filozofisko atziņu formulēšanu. Šeit jāatzīmē montāžas, skaņas un kameras kustības ietekme uz laikapziņu un jo īpaši virtualitātes un laiktēla nojēgumu attīstību, un to kā tie tiek realizēti kino caur sapni, retrospekciju un iztēloto laiku. Darba noslē…

laiktēlskinoestētikaŽils DelēzsattēlsFilozofijavirtualitāte
researchProduct