Search results for "NOS"

showing 10 items of 30869 documents

Finite-frequency spin susceptibility and spin pumping in superconductors with spin-orbit relaxation

2020

Static spin susceptibility of superconductors with spin-orbit relaxation has been calculated in the seminal work of A.A. Abrikosov and L.P. Gor'kov [Sov. Phys. JETP, {\bf 15}, 752 (1962)]. Surprisingly the generalization of this result to finite frequencies has not been done despite being quite important for the modern topic of superconducting spintronics. The present paper fills this gap by deriving the analytical expression for spin susceptibility. The time-dependent spin response is shown to be captured by the quasiclassical Eilenberger equation with collision integrals corresponding to the ordinary and spin-orbit scattering. Using the developed formalism we study the linear spin pumping…

suprajohtavuusFOS: Physical sciences02 engineering and technologyspin dynamics01 natural sciencessuprajohteetSuperconductivity (cond-mat.supr-con)Condensed Matter::Superconductivity0103 physical sciences010306 general physicsPhysicsSuperconductivityspintronicsSpin pumpingSpintronicsCondensed matter physicsScatteringCondensed Matter - Superconductivity021001 nanoscience & nanotechnologyspin relaxationspin-orbit couplingFormalism (philosophy of mathematics)Ferromagnetismspin (kvanttimekaniikka)Condensed Matter::Strongly Correlated Electrons0210 nano-technology
researchProduct

Proximity Effect in Superconducting Heterostructures with Strong Spin-Orbit Coupling and Spin Splitting

2019

It has been shown that singlet Cooper pairs can be converted into triplet ones and diffuse into a ferromagnet over a long distance in a phenomenon known as the long-range proximity effect (LRPE). This happens in materials with inhomogeneous magnetism or spin-orbit coupling (SOC). Most of the previous studies focus on the cases with small SOC and exchange field. However, the physics was not clear when SOC and exchange field strength are both much greater than the disorder strength. In this work, we consider a two dimensional system with a large Rashba-type SOC and exchange field in the case where only one band is partially occupied. We develop a generalized quasiclassical theory by projectin…

suprajohtavuusField (physics)FOS: Physical sciencesField strength02 engineering and technology01 natural sciencessuprajohteetSuperconductivity (cond-mat.supr-con)0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)magnetismi010306 general physicsSpin-½PhysicsCondensed matter physicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter - SuperconductivitySpin–orbit interactionDisordered Systems and Neural Networks (cond-mat.dis-nn)Condensed Matter - Disordered Systems and Neural Networks021001 nanoscience & nanotechnologyFerromagnetismT-symmetryCooper pair0210 nano-technologyProximity effect (atomic physics)
researchProduct

Superfluid weight and Berezinskii-Kosterlitz-Thouless transition temperature of twisted bilayer graphene

2019

We study superconductivity of twisted bilayer graphene with local and non-local attractive interactions. We obtain the superfluid weight and Berezinskii-Kosterlitz-Thouless (BKT) transition temperature for microscopic tight-binding and low-energy continuum models. We predict qualitative differences between local and non-local interaction schemes which could be distinguished experimentally. In the flat band limit where the pair potential exceeds the band width we show that the superfluid weight and BKT temperature are determined by multiband processes and quantum geometry of the band.

suprajohtavuusINSULATORsuperfluid densitymultiband superconductivityFOS: Physical sciences02 engineering and technologyBKT transition01 natural sciences114 Physical sciencessuperconducting phase transitionSuperconductivity (cond-mat.supr-con)SuperfluidityMAGIC-ANGLEsuperconducting fluctuationsnanorakenteetCondensed Matter::SuperconductivityMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesgrafeeni010306 general physicsQuantumPhysicsSuperconductivityCondensed Matter::Quantum GasesCondensed matter physicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter::OtherSUPERCONDUCTIVITYCondensed Matter - SuperconductivityORDER021001 nanoscience & nanotechnologySTATEsuperconducting RFKosterlitz–Thouless transitionPairingDENSITYBerry connection and curvature0210 nano-technologyBilayer graphene
researchProduct

Competition of electron-phonon mediated superconductivity and Stoner magnetism on a flat band

2018

The effective attractive interaction between electrons, mediated by electron-phonon coupling, is a well-established mechanism of conventional superconductivity. In metals exhibiting a Fermi surface, the critical temperature of superconductivity is exponentially smaller than the characteristic phonon energy. Therefore, such superconductors are found only at temperatures below a few kelvin. Systems with flat energy bands have been suggested to cure the problem and provide a route to room-temperature superconductivity, but previous studies are limited to only BCS models with an effective attractive interaction. Here we generalize Eliashberg's theory of strong-coupling superconductivity to syst…

suprajohtavuusMagnetismFOS: Physical sciences02 engineering and technologyElectron01 natural sciencesSuperconductivity (cond-mat.supr-con)Condensed Matter::Superconductivity0103 physical sciencessurface statesmagnetismi010306 general physicsQuantumPhase diagramSuperconductivityPhysicsta114Condensed matter physicssuperconductivityCondensed Matter - SuperconductivityFermi surface021001 nanoscience & nanotechnologyCoupling (physics)magnetismodd-frequency superconductivityelectron-phonon coupling0210 nano-technologyDispersion (chemistry)phase diagrams
researchProduct

Field dependence of the vortex-core sizes in dirty two-band superconductors

2019

We study the structure of Abrikosov vortices in two-band superconductors for different external magnetic fields and different parameters of the bands. The vortex core size determined by the coherence lengths are found to have qualitatively different behaviour from that determined by the quasiparticle density of states spatial variation. These different vortex core length scales coincide near the upper critical field, while the discrepancy between them becomes quite significant at lower fields. Within the diffusive approximation we demonstrate several generic regimes in the field dependence of the vortex core sizes determined by the disparity of diffusion constants in the two bands.

suprajohtavuusmultiband superconductivityFOS: Physical sciences02 engineering and technology01 natural sciencessuprajohteetSuperconductivity (cond-mat.supr-con)disordered systemsCondensed Matter::Superconductivity0103 physical sciences010306 general physicsCritical fieldPhysicsSuperconductivityCondensed matter physicsCondensed Matter - Superconductivityvortices in superconductors021001 nanoscience & nanotechnologycoherence lengthMagnetic fieldVortexScattering ratePairingDensity of statesQuasiparticle0210 nano-technology
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Chirality selective spin interactions mediated by the moving superconducting condensate

2018

We show that superconducting correlations in the presence of nonzero condensate velocity can mediate the peculiar interaction between localized spins that breaks the global inversion symmetry of magnetic moments. The proposed interaction mechanism is capable of removing fundamental degeneracies between topologically distinct magnetic textures. For the generic system of three magnetic impurities in the current-carrying superconductor, we find the energy term proportional to spin chirality. In realistic superconductor/ferromagnetic/superconductor setups we reveal significant energy differences between various magnetic textures with opposite chiralities. We calculate Josephson energies of junc…

suprajohtavuusskyrmionsmagnetic textureexchange interaction02 engineering and technology01 natural sciencessuprajohteetCondensed Matter::Superconductivityimpurities in superconductors0103 physical sciencesmagnetismi010306 general physicsSpin (physics)RKKY interactionPhysicsSuperconductivityMagnetic momentSpintronicsCondensed matter physicsSpinsta114SkyrmionJosephson effect021001 nanoscience & nanotechnologyChirality (electromagnetism)Ferromagnetismhelicoidal magnetic texture0210 nano-technologymagnetic vorticesPhysical Review B
researchProduct

Normal-Metal–Insulator–Superconductor Tunnel Junction With Atomic-Layer-Deposited Titanium Nitride as Superconductor

2015

suprajohtavuusta114thermometrythin filmsuperconductivityta22102 engineering and technologyatomikerroskasvatus021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesElectronic Optical and Magnetic Materialstunnel junctionspseudogapatomic layer deposition0103 physical sciencesElectrical and Electronic Engineering010306 general physics0210 nano-technologyta116IEEE Transactions on Applied Superconductivity
researchProduct

The Hexameric Resorcinarene Capsule as a Brønsted Acid Catalyst for the Synthesis of Bis(heteroaryl)methanes in a Nanoconfined Space

2019

Herein, we show that the hexameric resorcinarene capsule C is able to catalyze the formation of bis(heteroaryl)methanes by reaction between pyrroles or indoles and carbonyl compounds (α-ketoesters or aldehydes) in excellent yields and selectivity. Our results suggest that the capsule can play a double catalytic role as a H-bond catalyst, for the initial activation of the carbonyl substrate, and as a Bronsted acid catalyst, for the dehydration of the intermediate alcohol.

supramolecular organocatalysisAlcohol02 engineering and technology010402 general chemistry01 natural sciencesCatalysislcsh:Chemistrychemistry.chemical_compoundPolymer chemistryBrønsted acid catalystOriginal ResearchChemistrySubstrate (chemistry)CapsuleH-bond catalystGeneral Chemistryself-assemblyResorcinareneSupramolecular organocatalysis; Resorcinarene hexameric capsule; Bis(heteroaryl)methanes; Self-assembly; H-bond catalyst; Brønsted acid catalyst021001 nanoscience & nanotechnology0104 chemical sciencesChemistrylcsh:QD1-999Self-assembly0210 nano-technologyBrønsted–Lowry acid–base theorySelectivityresorcinarene hexameric capsulebis(heteroaryl)methanesFrontiers in Chemistry
researchProduct

Antibacterial Activity of Positively and Negatively Charged Hematite (α-Fe2O3) Nanoparticles to Escherichia coli, Staphylococcus aureus and Vibrio fi…

2021

This research and work has been supported by the European Regional Development Fund within the Activity 1.1.1.2 “Post-doctoral Research Aid” of the Specific Aid Objective 1.1.1 (i.e., “to increase the research and innovative capacity of scientific institutions of Latvia and the ability to attract external financing, investing in human resources and infrastructure”) of the Operational Programme “Growth and Employment” (No. 1.1.1.2/VIAA/2/18/331).

surface chargeGeneral Chemical EngineeringMicrobeJ02 engineering and technologymedicine.disease_causeArticlehematite<i>α</i>-Fe<sub>2</sub>O<sub>3</sub> nanoparticleslcsh:ChemistryAgar plate03 medical and health sciences:NATURAL SCIENCES:Physics [Research Subject Categories]medicineBioluminescenceGeneral Materials ScienceEscherichia colinano-bio interactions030304 developmental biology0303 health sciencesα-Fe2O3 nanoparticlesenvironmental safetybiologyChemistryBioluminescent bacteria021001 nanoscience & nanotechnologybiology.organism_classificationVibriohydrothermal synthesisantibacteriallcsh:QD1-999confocalStaphylococcus aureus0210 nano-technologyAntibacterial activityBacteriaNuclear chemistryNanomaterials
researchProduct