Search results for "NRA"

showing 10 items of 321 documents

Conrad Under Polish Eyes - or: is Conrad still "one of us"?

2015

This article discusses the attitude of Polish Conrad scholars towards Conrad and his works from the very beginning of his literary career to the present day, discussing the way they have perceived Conrad’s national identity and his cultural belonging. Although I aim to present a review of Polish criticism over the years, I pay particular attention to modern criticism, i.e. that of the period since the end of the Second World War, which includes the years of de facto communist rule (1945-1989). I try to determine whether Conrad is still “one of us”, whether he can be perceived as a moralist in the twenty-fi rst century and whether there is a need for such a moralist in present-day Poland.

communist ruleConradian valuesliterary criticismcensorshipJospeh ConradHome ArmyYearbook of Conrad Studies
researchProduct

Case-based portraits of contrasting micro-interaction processes during online assessment of collaborative problem solving

2017

This study recognizes the role and the quality of social aspects in collaborative problem solving (CPS) processes and outcomes. The aim of this study, relying on multiple data and phases of analysis, is to explore and visualise, through contrasting case-based portraits, how micro-interaction processes at pair level evolve during CPS assessments in an online environment. The assessment is designed for a student pair in the STEM domain. The results show that in despite students’ similar CPS performance scores, variations in micro-interactions occurred across pairs. It is expected that studying these patterns at pair level may provide new insights into CPS processes and so to support acquiring…

computer-supported collaborative learningdirected content analysisoppiminenongelmanratkaisuyhteisöllinen oppiminenpeer interactionkvalitatiivinen tutkimuscollaborationsocial aspectsteachingcase studiesyhteistyö
researchProduct

Commento all'art. 108 del d.lgs. 267/2000

2009

Il comemnto si occupa della figura del direttore generale e dela sua disciplina

direttore genrale nomina revoca poteriSettore IUS/07 - Diritto Del Lavoro
researchProduct

'Another Art Altogether': Heart of Darkness come romanzo breve

2002

By referring to a number of studies on Joseph Conrad as well as to critical works on the novella as a modern narrative form (from Henry James to Leibowitz, Nemerov and Kundera), this article explores how a reading of Heart of Darkness as a short novel can add new nuances to a better appreciation of Conrad's masterpiece.

doppelgängerquestModernismcolonialism.Joseph ConradThe novellaShort novelHeart of DarkneSettore L-LIN/10 - Letteratura Inglese
researchProduct

Indigon sinisestä kokenillin punaiseen : tekstiilivärjäyksessä käytettyjen luonnonväriaineiden tuonti Suomeen (1791–1856)

2022

Tutkimme ulkomaisten luonnonväriaineiden tuontia Suomeen 1790-luvun alusta 1850-luvun puoliväliin. Ajankohtaa voidaan luonnehtia murroskaudeksi väriaineiden käytön historiassa. Selvitämme mitä väriaineita Suomeen tuotiin, millaisia määriä, minneniitä tuotiin sekä mistä satamista väriainelastit olivat lähtöisin. Lähdeaineistomme perustan muodostavat Tanskan Juutinrauman tullitilit, joista on koostettu suomalaisia satamia koskeva tietokanta (FIN-STRO: 1560/1791–1856). Lähdepohjaa on täydennetty muulla tilastoaineistolla sekä laadullisella materiaalilla, kuten värjäysoppailla ja Kansalliskirjaston digitaalisella sanomalehtiarkistolla. Tutkimme erityisesti sinistä, punaista ja keltaista väriä t…

dye stuffsväriaineettalousJuutinrauman tullitilittaloushistoriaEconomydyeingtuontitulli-ilmoituksetulkomaankauppavärjäysimportSound Toll RegistersSuomimuotikulutuskulttuuriforeign tradenineteenth centuryFinlandVertaisarvioitu artikkeli1800-lukukasvivärit
researchProduct

Satamasedimenttien ekotoksikologinen riskinarviointi

2008

ekotoksikologiaPAH-yhdisteetLappeenrantaJyväskyläsukkulamadotsatamatsedimentitriskinarviointisisävedet
researchProduct

Kārļa Padega grafika kā iedvesmas avots vizuālās mākslas stundās 9.klasē

2018

Diplomdarba “Kārļa Padega grafika kā iedvesmas avots vizuālās mākslas stundās 9.klasē ” mērķis ir iepazīt un izpētīt Kārļa Padega grafiskos izteiksmes paņēmienus un to izmantošanas iespējas vizuālās mākslas stundās 9.klasē, radot ekspresīvu un izteiksmes līdzekļiem bagātu tušas zīmējumu. Diplomdarba uzdevumu ietvarā ir apzināta literatūra par latviešu mākslinieku Kārli Padegu, raksturota K. Padega grafiskā daiļrade un tušas tehnikas specifika. Uzdevumu kopas izveidei ir izvērtēta pedagoģiskā un psiholoģiskā literatūra, kas atbilstu pusaudžu vecumposma īpašībām. Uzdevumu kopas četri uzdevumi ir realizēti pedagoģiskajā izmēģinājumā no kura secināms, ka K. Padega grafiskā daiļrade spēj iedvesm…

ekspresijaPedagoģijatušas zīmējumsindividualitātejaunradeKārlis Padegs
researchProduct

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

Effect of lithium ions on the catalytic efficiency of calcium oxide as a nanocatalyst for the transesterification of lard oil

2019

The present work encompasses the effect of Li+ ions on CaO nanoparticles for the transesterification of lard oil. The modification of CaO nanoparticles was achieved by the impregnation of different molar ratios of lithium hydroxide. Later, each catalyst was screened for the catalytic conversion of lard oil to a fatty acid methyl ester (FAME). The nanocatalyst CaO–0.5LiOH (1 : 0.5 molar ratio) showed the best conversion rate for FAME. The synthesized nanocatalyst was characterized using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM), Brunauer–Emmett–Teller (BET) analysis, and Hammett indicato…

esterit020209 energyEnergy Engineering and Power Technologychemistry.chemical_element02 engineering and technologykalkki010501 environmental sciences01 natural sciencesLithium hydroxideCatalysischemistry.chemical_compoundkatalyytit0202 electrical engineering electronic engineering information engineeringFourier transform infrared spectroscopybiopolttoaineetFatty acid methyl ester0105 earth and related environmental scienceseläinrasvatRenewable Energy Sustainability and the EnvironmentTransesterificationFuel TechnologylitiumchemistryYield (chemistry)Proton NMRnanohiukkasetLithiumNuclear chemistrySustainable Energy & Fuels
researchProduct

The “Architectures” of Successful Remote Collaborative Problem Solving : Exploring Commitment in Dyadic Interaction

2022

During successful collaborative problem solving (CPS), participants are expected not only to share and process information to solve the task, but also to show responsiveness and commitment to their partners. Accordingly, this exploratory study aims, via two contrasting cases, to acquire a preliminary understanding of how commitments and successful CPS come together in remote, dyadic interaction. To do so, the study relies on objective and subjective measures and combines group with individual levels of analysis on log files and cued interviews. The results revealed how commitments were interrelated with efficient coordination of interactions during CPS. Coordinated, well-communicated proble…

etäopiskeluvuorovaikutusverkko-opiskeluongelmanratkaisusitoutuminenyhteisöllinen oppiminen
researchProduct