Search results for "Neet"

showing 10 items of 1432 documents

Karjalaisten evakkojen laulujen siirtyminen sukupolvelta toiselle

2014

Tässä tutkimuksessa tarkastellaan laulujen siirtymistä sukupolvelta toiselle. Siirtyminen itsessään on yhtä vanha kuin ihminenkin. Sen avulla on välitetty tietoa ja samalla ylläpidetty kulttuuria, jotka kummatkin ovat aikoinaan olleet elinarvoisen tärkeitä ihmisen hengissä selviytymisen kannalta. Tutkimuksessa tarkastellaan miten laulut ovat periytyneet sukupolvelta toiselle tutkimalla löytyykö eri sukupolvien väliltä yhteisiä lauluja ja millaisessa sosiaalisessa kanssakäymisessä nämä laulut ovat siirtyneet. Tutkimus on tehty karjalaisen evakkosuvun keskuudessa. Siirtymisen kannalta ei ole väliä millaisesta laulusta on kyse, mutta tutkimuksessa nousi esiin sellaisia lauluja, jotka tutkittav…

evakkosiirtyminenaineeton kulttuuriperintöteemahaastatteluKarjalasuullinen perimätieto
researchProduct

Memory-saving optimization algorithms for systems with limited hardware

2011

evolutionary algorithmmemetic algorithmdifferentiaalievoluutiodifferential evolutiontietämystekniikkamemeettiset algoritmitgeneettiset algoritmitglobal optimizationevoluutioalgoritmitcomputational ingelligencelaskennallinen älykkyysevoluutiolaskentacompact optimizationtekoälymatemaattinen optimointialgorithmic enhancementskoneoppiminenoptimointioptimointimenetelmätmemetic computingalgoritmitevolutionary computingpopulation-less optimizationsingle-solution optimization
researchProduct

Exploring heterogeneous ICT use among older adults: The warm experts’ perspective

2020

In this article, we (1) examine the various forms of support required by older users (75+) of digital technology and (2) provide a concrete, everyday life rationale for why warm experts play such a pivotal role in the processes of adopting and using ICT. Although warm experts are usually not older adults themselves, they provide an important mediating view on the technology use among older people that has not been rigorously addressed in previous studies. Thus, in our analysis we examine the younger family members’ views on acting as warm experts to their older family members. The research data consist of 22 extended group interviews (EGI) and observation carried out in Finland. Based on ou…

familyperheenjäsenet020205 medical informaticsSociology and Political Sciencetieto- ja viestintätekniikka050801 communication & media studies02 engineering and technology0508 media and communications0202 electrical engineering electronic engineering information engineeringSociologyEveryday lifeomaksuminenwarm expertbusiness.industryCommunicationaging05 social sciencesPerspective (graphical)Public relationsdigitaalitekniikkatukimuodotikääntyminenInformation and Communications TechnologyICTohjaus (neuvonta ja opastus)digital technologybusinessikääntyneetNew Media & Society
researchProduct

Functional muscle architecture in aging

2014

fascicletrainingtendonvoimantuottoagingjoint stiffness regulationlihaksetultrasonographyneural controlmuscle mechanicsjänteetikääntyminenhermo-lihastoimintastretch-shortening cycleharjoitteluultraäänitutkimusbiomekaniikkaliikkuminenikääntyneet
researchProduct

Technicolor and new matter generations

2010

This work consists of an overview part and three research papers. The subject of this work is a class of models for dynamical electroweak symmetry breaking, and new generations of fermionic matter. An introductory overview of the standard model of electroweak interactions is given, as well as an overview of some of the recent developments in the field of walking technicolor models. We study some recently proposed models for dynamical electroweak symmetry breaking, namely the minimal walking technicolor (MWT) and next to minimal walking technicolor (NMWT) model. We show that, as a result of cancellation of the global and gauge anomalies associated with the technicolor sector, a non sequentia…

fermionitkvarkitHigh Energy Physics::PhenomenologyHigh Energy Physics::ExperimentvektoribosonitperustutkimushiukkasfysiikkaHiggsin hiukkanenvälittäjäaineettekniväriainesukupolvetalkeishiukkaset
researchProduct

Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

2020

 Intensiivinen tekniikka. Välitön aineellisuus ja luova teknisyys Gilles Deleuzen filosofiassa

filosofitkapitalismimetafysiikkatietotekniikkainformaatiokoneetkulttuurifilosofiayhteiskuntafilosofialuovuusteknologiaDeleuze GillessynteesiLektiotGuattari FélixmateriaalisuusAjatus
researchProduct

Maailma fossiilitalouden jälkeen

2022

Ilmastonmuutos edellyttää fossiilitaloudesta luopumista. Yhteiskunnan energia- ja materiaperustan muutos vaatii uudenlaisia politiikkakeinoja, rakenteita, toimintatapoja, tuotteita ja hallintamalleja. Ilmastonmuutos johtuu fossiilitaloudesta: öljy- ja maakaasukentiltä ja kivihiilikaivoksista peräisin olevan hiilen pumppaamisesta ilmakehään. Tätä on kiihdyttänyt väestön ja kulutuksen eli talouden kasvu. Jotta ilmastonmuutosta voitaisiin hillitä, fossiilitaloudesta täytyy luopua. Muutos on valtava, kun yhteiskunnan koko metabolinen perusta muuttuu. Meistä kaukana ja näkymättömissä olevista fossiilienergian lähteistä siirrytään meidän keskellämme oleviin energialähteisiin: tuuleen, veteen, aur…

fossiiliset polttoaineetmaaseutumateriaalityhteiskuntatulevaisuusilmastonmuutoksetluonnonvaratenergialähteet
researchProduct

Vuorovaikutuskaavion käytön vaikutus voimakäsitteen oppimiseen lukion mekaniikan opetusjaksoilla

2014

free body diagramNewtonin laitvuorovaikutusmekaniikkaoppiminenoppiaineetinteractioninteraction diagramlukiorepresentaatioopetusmenetelmätvoimafysiikkaforceNewton's law
researchProduct

Lowered nutritional quality of prey decrease the growth and biomolecule content of rainbow trout fry

2022

Diet quality is crucial for the development of offspring. Here, we examined how the nutritional quality of prey affects somatic growth and the lipid, carbohydrate, protein, amino acid, and polyunsaturated fatty acid content of rainbow trout (Oncorhynchus mykiss) fry using a three-trophic-level experimental setup. Diets differed especially in their content of eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA), which are physiologically essential polyunsaturated fatty acids for a fish fry. Trout were fed with an artificial diet (fish feed, DHA-rich), marine zooplankton diet (krill/Mysis, DHA-rich), or freshwater zooplankton diet (Daphnia, Cladocera, DHA-deficient). The Daphnia were gr…

freshwater food websDocosahexaenoic AcidsPhysiologyrasvahapotBiochemistrypoikasetkirjolohiAnimalsravintoaineetMolecular BiologykalatfishArachidonic AcidFatty Acids Essentialrehevöityminenplanktonvesiekosysteemitdaphniadocosahexaenoic acidomegarasvahapotDieteutrophicationEicosapentaenoic AcidOncorhynchus mykissphytoplanktonvesikirputravintoarvoNutritive Valueravintoverkotpolyunsaturated fatty acids
researchProduct

Design and simulation of efficient combinational circuits based on a new XOR structure in QCA technology

2021

AbstractQuantum-dot cellular automata (QCA), due to its unique characteristics like low power consumption, nanoscale design, and high computing speed is considered as an emerging technology, and it can be used as an alternative for CMOS technology in circuit design for quantum computers in the near future. XOR gate has many applications in the design of digital circuits in QCA. In this paper, an efficient novel structure of XOR gate is proposed in QCA. Also, a novel 1-bit comparator circuit, 1-bit full adder, binary to gray and gray to binary convertor code based on the proposed XOR is designed and simulated using QCADesigner 2.0.3. The simulation results demonstrated that the proposed stru…

full adderAdderComparatorComputer scienceCircuit designelektroniset piiritBinary numberHardware_PERFORMANCEANDRELIABILITYElectronic engineeringHardware_INTEGRATEDCIRCUITSElectrical and Electronic EngineeringHardware_ARITHMETICANDLOGICSTRUCTURESXOR gateCombinational logicDigital electronicsbusiness.industrykvanttitietokoneetkvanttilaskentaconverterAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic MaterialsCMOSsoluautomaatitbusinessquantum-dot cellular automataXOR gatecomparatorHardware_LOGICDESIGN
researchProduct