Search results for "Negative"

showing 10 items of 1052 documents

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Real space observation of two-dimensional Bloch wave interferences in a negative index photonic crystal cavity

2008

We report here the direct observation of two-dimensional (2D) Bloch wave interferences in a negative index photonic crystal by using optical near-field microscopy techniques. The photonic crystal is formed by a defectless honeycomb lattice of air holes etched in III-V semiconductor slab. A scanning near-field optical microscope is used to visualize spatially, as well as spectrally, the light distribution inside the photonic crystal. The recorded near-field spectra and maps presented here unambiguously demonstrate the Bloch wave interferences within the photonic crystal. Then, the spectral and spatial evolution of these interferences allows us to recover experimentally the 2D band diagram of…

010302 applied physicsPhysicsbusiness.industryPhysics::OpticsMicrostructured optical fiberCondensed Matter Physics01 natural sciencesYablonoviteElectronic Optical and Magnetic MaterialsOpticsSemiconductorNegative refraction0103 physical sciencesMicroscopyBand diagram[SPI.OPTI]Engineering Sciences [physics]/Optics / Photonic[SPI.NANO]Engineering Sciences [physics]/Micro and nanotechnologies/Microelectronics010306 general physicsbusinessComputingMilieux_MISCELLANEOUSPhotonic crystalBloch wave
researchProduct

Data Reweighting in Metadynamics Simulations.

2020

The data collected along a metadynamics simulation can be used to recover information about the underlying unbiased system by means of a reweighting procedure. Here, we analyze the behavior of several reweighting techniques in terms of the quality of the reconstruction of the underlying unbiased free energy landscape in the early stages of the simulation and propose a simple reweighting scheme that we relate to the other techniques. We then show that the free energy landscape reconstructed from reweighted data can be more accurate than the negative bias potential depending on the reweighting technique, the stage of the simulation, and the adoption of well-tempered or standard metadynamics. …

010304 chemical physicsComputer science0103 physical sciencesMetadynamicsEnergy landscapePhysical and Theoretical ChemistryNegative bias01 natural sciencesAlgorithmEnergy (signal processing)Computer Science ApplicationsJournal of chemical theory and computation
researchProduct

SMOS Level-2 Soil Moisture Product Evaluation in Rain-Fed Croplands of the Pampean Region of Argentina

2016

A field campaign was carried out to evaluate the Soil Moisture (SM) MIR-SMUDP2 product (v5.51) generated from the data of the Microwave Imaging Radiometer using Aperture Synthesis (MIRAS) aboard the Soil Moisture and Ocean Salinity (SMOS) mission. The study area was the Pampean Region of Argentina, which was selected because it is a vast area of flatlands containing quite homogeneous rain-fed croplands, which are considered SMOS nominal land uses and hardly affected by radio-frequency interference contamination. Transects of ground handheld SM measurements were performed using ThetaProbe ML2x probes within four Icosahedral Snyder Equal Area Earth (ISEA) grid nodes, where permanent SM statio…

010504 meteorology & atmospheric sciences0211 other engineering and technologiesSoil science02 engineering and technologyAtmospheric sciences01 natural sciencesStandard deviationCiencias de la Tierra y relacionadas con el Medio AmbienteSOIL MOISTURE (SM)Electrical and Electronic EngineeringPRODUCT EVALUATIONWater contentField campaign021101 geological & geomatics engineering0105 earth and related environmental sciencesPhysicsRadiometerSOIL MOISTURE AND OCEAN SALINITY (SMOS)GROUND MEASUREMENTSNegative biasHomogeneousProduct (mathematics)Random errorGeneral Earth and Planetary SciencesMeteorología y Ciencias AtmosféricasCIENCIAS NATURALES Y EXACTASIEEE Transactions on Geoscience and Remote Sensing
researchProduct

Sr/Ca and Mg/Ca ratios of ontogenetically old, long-lived bivalve shells (Arctica islandica) and their function as paleotemperature proxies

2011

International audience; The Sr/Ca and Mg/Ca ratios of many biogenic skeletons provide useful paleotemperature estimates. As yet however, it has remained largely impossible to obtain such information from bivalve shells. In the present study, metal-to-calcium values in the hinge plate (aragonite, outer shell layer) of four ontogenetically old (85 to 374 year-old) specimens of the long-lived bivalve, Arctica islandica, were measured on a LA-ICP-MS. The shells were collected alive in 1868, 1986 and 2003 from three different localities around Iceland. With increasing ontogenetic age and decreasing growth rate, a distinct trend toward increasing Sr/Ca (max. 5.17 mmol/mol) and Mg/Ca values (max. …

010504 meteorology & atmospheric sciencesOntogenySea surface temperatureLongevityZoologyMineralogyAmbient waterengineering.materialSignificant negative correlation010502 geochemistry & geophysicsOceanography01 natural sciencesMetal-to-calcium ratioMole14. Life underwaterGrowth rateBivalve shellArctica islandicaEcology Evolution Behavior and Systematics0105 earth and related environmental sciencesEarth-Surface ProcessesVital effectbiologyAragonitePaleontologybiology.organism_classificationBivalve shell[SDE]Environmental Sciencesengineering
researchProduct

Chironomus riparius(Diptera) genome sequencing reveals the impact of minisatellite transposable elements on population divergence

2016

AbstractActive transposable elements (TEs) may result in divergent genomic insertion and abundance patterns among conspecific populations. Upon secondary contact, such divergent genetic backgrounds can theoretically give rise to classical Dobzhansky-Muller incompatibilities (DMI), a way how TEs can contribute to the evolution of endogenous genetic barriers and eventually population divergence. We investigated whether differential TE activity created endogenous selection pressures among conspecific populations of the non-biting midgeChironomus riparius,focussing on aChironomus-specific TE, the minisatellite-likeCla-element, whose activity is associated with speciation in the genus. Using an …

0106 biological sciences0301 basic medicineGenome Insectved/biology.organism_classification_rank.speciesPopulationGenomicsMinisatellite RepeatsBiologyPolymorphism Single Nucleotide010603 evolutionary biology01 natural sciencesGenomeChironomidaeDNA sequencingEvolution Molecular03 medical and health sciencesNegative selectionGeneticsAnimalseducationIn Situ Hybridization FluorescenceEcology Evolution Behavior and SystematicsLocal adaptationGeneticsChironomus ripariuseducation.field_of_studyPolytene chromosomeved/biologyfood and beveragesGenetics Population030104 developmental biologyMinisatelliteEvolutionary biologyDNA Transposable ElementsFemaleMolecular Ecology
researchProduct

2017

Both effective population size and life history may influence the efficacy of purifying selection, but it remains unclear if the environment affects the accumulation of weakly deleterious nonsynonymous polymorphisms. We hypothesize that the reduced energetic cost of osmoregulation in brackish water habitat may cause relaxation of selective constraints at mitochondrial oxidative phosphorylation (OXPHOS) genes. To test this hypothesis, we analyzed 57 complete mitochondrial genomes of Pungitius pungitius collected from brackish and freshwater habitats. Based on inter- and intraspecific comparisons, we estimated that 84% and 68% of the nonsynonymous polymorphisms in the freshwater and brackish …

0106 biological sciences0301 basic medicineNonsynonymous substitutionGeneticseducation.field_of_studyMitochondrial DNAEcologyPopulationEuryhalineBiologybiology.organism_classification010603 evolutionary biology01 natural sciencesGenetic load03 medical and health sciencesNegative selection030104 developmental biologyPungitiusEffective population size14. Life underwatereducationEcology Evolution Behavior and SystematicsNature and Landscape ConservationEcology and Evolution
researchProduct

Long-term changes in winter abundance of the barbastelle Barbastella barbastellus in Poland and the climate change - Are current monitoring schemes s…

2020

Warmer winters may lead to changes in the hibernation behaviour of bats, such as the barbastelle Barbastella barbastellus, which prefers to hibernate at low temperatures. The species is also known for its large annual fluctuations in the number of wintering individuals, so inference about population trends should be based on long-term data. Prior to 2005, analyses indicated stable or even increasing barbastelle population in Poland. We analysed the results of 13 winter bat counts (2005–2017) of the species from 15 of the largest hibernacula, and additional site of 47 small bunkers, in Poland. The total number of wintering individuals remained stable during the study period, because the barb…

0106 biological sciencesAtmospheric ScienceTime Factors010504 meteorology & atmospheric sciencesPhysiologySocial Sciences01 natural sciencesGeographical locationsAbundance (ecology)ChiropteraHibernationBatsMedicine and Health SciencesPsychologyClimatologyMammalseducation.field_of_studyMultidisciplinarybiologyGeographyAnimal BehaviorEcologyQRTemperatureEukaryotaCurrent (stream)EuropeBarbastella barbastellusGeographyResearch DesignVertebratesMedicineRegression AnalysisSeasonsNegative correlationEnvironmental MonitoringResearch ArticleCensusScienceClimate ChangePopulationClimate changeResearch and Analysis Methods010603 evolutionary biologyAnimalsEuropean Unioneducation0105 earth and related environmental sciencesBehaviorSurvey ResearchWinterOrganismsBiology and Life Sciencesbiology.organism_classificationAmniotesEarth SciencesPolandPeople and placesPhysiological ProcessesZoologyPloS one
researchProduct

Management Elements for Two Alburninae Species, Alburnus alburnus (Linnaeus, 1758) and Alburnoides bipunctatus (Bloch, 1782) Based on a Decision-Supp…

2019

Abstract ADONIS:CE has been used as a base to create a support-system management decision-making model for Alburnus alburnus (Linnaeus, 1758) and Alburnoides bipunctatus (Bloch, 1782) species. Investigation of the habitat necessities and the identification of the necessary elements for a good status of conservation of these two fish species populations has revealed the pressures and threats to these congener species, for which specific management activities have been finally recommended.

0106 biological sciencesDecision support systemThesaurus (information retrieval)biologyEcologybusiness.industry010604 marine biology & hydrobiology010501 environmental scienceshuman activities negative effectscomputer.software_genrebiology.organism_classification01 natural sciencesAlburnus alburnusschneiderGeographyAlburnoides bipunctatusbleakArtificial intelligencefish habitat needsbusinesscomputerconservation management elementsNatural language processingQH540-549.50105 earth and related environmental sciencesTransylvanian Review of Systematical and Ecological Research
researchProduct

Phylogeography and Molecular Evolution of Potato virus Y

2012

Potato virus Y (PVY) is an important plant pathogen, whose host range includes economically important crops such as potato, tobacco, tomato, and pepper. PVY presents three main strains (PVYO, PVYN and PVYC) and several recombinant forms. PVY has a worldwide distribution, yet the mechanisms that promote and maintain its population structure and genetic diversity are still unclear. In this study, we used a pool of 77 complete PVY genomes from isolates collected worldwide. After removing the effect of recombination in our data set, we used Bayesian techniques to study the influence of geography and host species in both PVY population structure and dynamics. We have also performed selection and…

0106 biological sciencesEvolutionary GeneticsAmino-acid sitesSelective constraintsPotyviruslcsh:Medicine01 natural sciencesAmino-Acid SitesRecombinant strainPlant RNA virusesNegative selectionMaximum-Likelihoodlcsh:Sciencepathologie végétaleSelective ConstraintsPhylogenyGenetics0303 health sciencesCoat proteinMultidisciplinaryNatural selectionVegetal BiologybiologyEcologyGenetic-structurePotyvirusfood and beveragesEuropePhylogeneticsVenous necrosisPhylogeographyPotato virus YBiogeographyVenous NecrosisSequence AnalysisResearch ArticlePlant RNA VirusesGenome ViralMicrobiologyEvolution Molecular03 medical and health sciencesGenetic-StructureMolecular evolutionVirologyMosaic-virus[SDV.BV]Life Sciences [q-bio]/Vegetal BiologyEvolutionary SystematicsBiology030304 developmental biologySolanum tuberosumGenetic diversityEvolutionary BiologyMosaic virusHost (biology)Maximum-likelihoodlcsh:RComputational Biologyvirus à de la pomme de terreBayes Theoremlégumebiology.organism_classificationMutational analysisMosaic-VirusMutational AnalysisEvolutionary EcologyRecombinant StrainNorth Americalcsh:QBiologie végétalePopulation Genetics010606 plant biology & botany
researchProduct