Search results for "Normal"

showing 10 items of 2571 documents

Pareto or log-normal? A recursive-truncation approach to the distribution of (all) cities

2012

Traditionally, it is assumed that the population size of cities in a country follows a Pareto distribution. This assumption is typically supported by finding evidence of Zipf's Law. Recent studies question this finding, highlighting that, while the Pareto distribution may fit reasonably well when the data is truncated at the upper tail, i.e. for the largest cities of a country, the log-normal distribution may apply when all cities are considered. Moreover, conclusions may be sensitive to the choice of a particular truncation threshold, a yet overlooked issue in the literature. In this paper, then, we reassess the city size distribution in relation to its sensitivity to the choice of truncat…

jel:D30jel:C46jel:R12City size distribution; Pareto and Log-normal; Zipf's Law; Kolmogorov- Smirnov; Recursive analysis
researchProduct

ESTUDIO DEL EFECTO INFORMATIVO DEL ANUNCIO DE BENEFICIOS TRIMESTRALES

2005

In this research we investigate whether quarterly earnings announcements are informative using awide sample of firms listed in the Spanish Stock Market (SIBE). We study the period comprised between thethird quarterly of 2002 and the fourth quarterly of 2003. We analyse whether abnormal returns are related tothe quarter in which the announcement is released, whether the announcement implies good or bad news forthe firm, the source of the information, the size of the firm and whether the firm is followed by analysts.Results show that quarterly earnings announcements are informative. We also obtain evidence of a possibleuse of insider information in the case of the announcements disclosed in t…

jel:G14jel:G19Anuncio de beneficios trimestrales rendimiento anormal información privilegiada Quarterly earnings announcements abnormal returns insider information.jel:G12
researchProduct

High-energy resummation effects in the production of Mueller-Navelet dijet at the LHC

2016

We study the production of two forward jets with a large interval of rapidity at hadron colliders, which was proposed by Mueller and Navelet as a possible test of the high energy dynamics of QCD, within a complete next-to-leading logarithm framework. We show that using the Brodsky-Lepage-Mackenzie procedure to fix the renormalization scale leads to a very good description of the recent CMS data at the LHC for the azimuthal correlations of the jets. We show that the inclusion of next-to-leading order corrections to the jet vertex significantly reduces the importance of energy-momentum non-conservation which is inherent to the BFKL approach, for an asymmetric jet configuration. Finally, we ar…

jetsCOLLISIONSParticle physicsLogarithmQC1-999Hadronenergy-momentumFOS: Physical sciencesPartonPART114 Physical sciences01 natural sciencesrenormalizationHigh Energy Physics - ExperimentRenormalizationHigh Energy Physics - Experiment (hep-ex)High Energy Physics - Phenomenology (hep-ph)RAPIDITY0103 physical sciencesSCATTERINGRapidityResummationPROBE010306 general physicsNLO JET VERTEXQCD POMERONBFKLPhysicsQuantum chromodynamicsliikeoppiLarge Hadron Colliderta114010308 nuclear & particles physicsPhysicsscatteringHigh Energy Physics::PhenomenologydijetHigh Energy Physics - PhenomenologykinematicsresummationTEVHigh Energy Physics::Experimentviolationhadronquantym chromodynamicsBDKL equationAPPROXIMATION
researchProduct

Crystallization and preliminary crystallographic analysis of the major capsid proteins VP16 and VP17 of bacteriophage P23-77.

2012

The major capsid proteins VP16 and VP17 of bacteriophage P23-77 have been crystallized using both recombinant and purified virus and preliminary diffraction analyses have been performed.

kapsidiproteiinitcongenital hereditary and neonatal diseases and abnormalitiesLineage (genetic)bacteriophagescrystallizationIcosahedral symmetryvirusesBiophysicsBacteriophage P23-77major coat proteinsCrystallography X-RayBiochemistrycapsid proteinsbakteriofagitlaw.inventionBacteriophage03 medical and health sciencesStructural BiologylawGeneticsCoat ProteinsCrystallizationskin and connective tissue diseasesdouble beta-barrel viral lineage030304 developmental biology0303 health sciencesbiologybakteriofaagit030306 microbiologyThermus thermophilusta1183ta1182Thermus thermophilusbiochemical phenomena metabolism and nutritionCondensed Matter Physicsbiology.organism_classification3. Good healthCrystallographyCapsidCrystallization CommunicationsRecombinant DNAhealth occupationsCapsid ProteinsCrystallization
researchProduct

Living standards and changing expectations : investigating domestic necessity and environmental sustainability in an affluent society

2017

This study explores how the problematic relations of rising living standards and environmental sustainability may be better understood by investigating domestic necessity and daily going-on. These key subjects are looked at from two angles and through two kinds of research material: statistics and quantitative survey material constituting of a nationally representative longitudinal dataset of Finnish people (n=2,417 in 1999, n=3,574 in 2004, n=1,202 in 2009), and in-depth interviews (n=14) of a particular socio-economic group, the well-to-do who have higher-than average income and higher education, and those in their prime working age (30–45 years-old). The survey material provides a tempor…

kestävä kulutuskestävä kehityselintasovaikutuksetsosiokulttuuriset tekijätekologisuusarkikotitaloudetdaily lifekulutuskuluttajakäyttäytyminensustainabilitysosioekonominen asemaarkielämänecessitynormalityeettinen kulutushyvinvointivaltiokulutustottumuksetekologinen kestävyyselämäntapastandard of livingympäristötietoisuus
researchProduct

Developments in many-body theory of quantum transport and spectroscopy with non-equilibrium Green's functions and time-dependent density functional t…

2015

The problem of quantum dynamics in open systems has gained attention in recent decades and not the least due to the advances made in quantum transport in molecular systems. The main motivation behind quantum transport and molecular electronics is the futuristic goal to be able at some point to replace, or to complement, the silicon-based technology and to make the electronic devices faster. On a fundamental level, one has to deal with time-dependent processes where electron-electron or electron- phonon interactions are of great importance, and they can cause profound quantitative and qualitative changes on the physical and dynamical properties of electronic systems compared to the non-inter…

kvanttikuljetuselektronikorrelaationanoelektroniikkatiheysfunktionaaliteoriamonen kappaleen häiriöteoriaGreenin funktiokvanttikemiakvanttimekaniikkakvanttifysiikkamolekyylielektroniikkaelektronittiheysmatriisirenormalisaatioryhmädynamiikka
researchProduct

SHIFTS OF START AND END OF SEASON IN RESPONSE TO AIR TEMPERATURE VARIATION BASED ON GIMMS DATASET IN HYRCANIAN FORESTS

2018

Abstract. Climate change is one of the most important environmental challenges in the world and forest as a dynamic phenomenon is influenced by environmental changes. The Hyrcanian forests is a unique natural heritage of global importance and we need monitoring this region. The objective of this study was to detect start and end of season trends in Hyrcanian forests of Iran based on biweekly GIMMS (Global Inventory Modeling and Mapping Studies) NDVI3g in the period 1981-2012. In order to find response of vegetation activity to local temperature variations, we used air temperature provided from I.R. Iran Meteorological Organization (IRIMO). At the first step in order to remove the existing g…

lcsh:Applied optics. PhotonicsSeries (stratigraphy)010504 meteorology & atmospheric scienceslcsh:TData reconstructionGlobal warming0211 other engineering and technologieslcsh:TA1501-1820Growing seasonClimate change02 engineering and technologyVegetationlcsh:Technology01 natural sciencesNormalized Difference Vegetation IndexGeographylcsh:TA1-2040ClimatologyAir temperaturelcsh:Engineering (General). Civil engineering (General)021101 geological & geomatics engineering0105 earth and related environmental sciences
researchProduct

Mapping daily evapotranspiration at field to continental scales using geostationary and polar orbiting satellite imagery

2011

Abstract. Thermal infrared (TIR) remote sensing of land-surface temperature (LST) provides valuable information about the sub-surface moisture status required for estimating evapotranspiration (ET) and detecting the onset and severity of drought. While empirical indices measuring anomalies in LST and vegetation amount (e.g., as quantified by the Normalized Difference Vegetation Index; NDVI) have demonstrated utility in monitoring ET and drought conditions over large areas, they may provide ambiguous results when other factors (e.g., air temperature, advection) are affecting plant functioning. A more physically based interpretation of LST and NDVI and their relationship to sub-surface moistu…

lcsh:GE1-350Meteorologylcsh:TPlanetary boundary layerSettore ICAR/02 - Costruzioni Idrauliche E Marittime E Idrologialcsh:Geography. Anthropology. RecreationPolar orbitVegetationlcsh:Technologyremote sensing mapping ET ALEXIlcsh:TD1-1066Normalized Difference Vegetation Indexlcsh:GEvapotranspirationGeostationary orbitEnvironmental scienceSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliSatelliteSatellite imagerylcsh:Environmental technology. Sanitary engineeringlcsh:Environmental sciencesRemote sensing
researchProduct

IL-12 Expands and Differentiates Human Vγ2Vδ2 T Effector Cells Producing Antimicrobial Cytokines and Inhibiting Intracellular Mycobacterial Growth

2019

While IL-12 plays a key role in differentiation of protective CD4+ Th1 response, little is known about mechanisms whereby IL-12 differentiates other T-cell populations. Published studies suggest that predominant Vγ2Vδ2 T cells in humans/nonhuman primates (NHP) are a fast-acting T-cell subset, with capacities to rapidly expand and produce Th1 and cytotoxic cytokines in response to phosphoantigen (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate (HMBPP) produced by Mycobacterium tuberculosis (Mtb) or others. However, whether IL-12 signaling pathway mediates fast-acting and Th1 or anti-microbial features of Vγ2Vδ2 T cells remains poorly defined. Here, we show that IL-12, but not other IL-12 fami…

lcsh:Immunologic diseases. AllergyCells1.1 Normal biological development and functioningproliferationImmunologyLymphocyte ActivationV gamma 2V delta 2 T cellsVaccine Related03 medical and health sciencesPhosphatidylinositol 3-Kinases0302 clinical medicineRare DiseasesUnderpinning researchT-Lymphocyte SubsetsImmunology and AllergyTuberculosis2.1 Biological and endogenous factorsHumansAetiologyIntraepithelial LymphocytesCells Cultured030304 developmental biologyOriginal Researchanti-tuberculosis0303 health sciencesCulturedVγ2Vδ2 T cellsTumor Necrosis Factor-alphaInflammatory and immune systemCorrectionCell DifferentiationMycobacterium tuberculosisdifferentiationSTAT4 Transcription FactorTh1 CellsInterleukin-12Organophosphates3. Good healthInfectious DiseasesGood Health and Well BeingMedical MicrobiologyIL-12Infectionlcsh:RC581-607Proto-Oncogene Proteins c-akt030215 immunologySignal TransductionFrontiers in Immunology
researchProduct

Progenitor death drives retinal dysplasia and neuronal degeneration in a mouse model of Atrip-Seckel syndrome

2020

ABSTRACT Seckel syndrome is a type of microcephalic primordial dwarfism (MPD) that is characterized by growth retardation and neurodevelopmental defects, including reports of retinopathy. Mutations in key mediators of the replication stress response, the mutually dependent partners ATR and ATRIP, are among the known causes of Seckel syndrome. However, it remains unclear how their deficiency disrupts the development and function of the central nervous system (CNS). Here, we investigated the cellular and molecular consequences of ATRIP deficiency in different cell populations of the developing murine neural retina. We discovered that conditional inactivation of Atrip in photoreceptor neurons …

lcsh:MedicineMedicine (miscellaneous)315BlindnessMicechemistry.chemical_compoundImmunology and Microbiology (miscellaneous)Cell DeathneurodevelopmentStem CellsNeurodegenerationapoptosisneurodegenerationSyndromeCell biologyDNA-Binding Proteinsdna damage responsemedicine.anatomical_structurePhotoreceptor Cells VertebrateResearch Articlelcsh:RB1-214NeurogenesisNeuroscience (miscellaneous)Embryonic DevelopmentBiologyRetinaGeneral Biochemistry Genetics and Molecular Biologylcsh:PathologymedicineAnimalsAbnormalities MultipleProgenitor cellVision OcularAdaptor Proteins Signal TransducingCell ProliferationProgenitorRetinalcsh:RRetinalEmbryo Mammalianmedicine.diseasephotoreceptorDisease Models AnimalSeckel syndromechemistryvisual system developmentNerve DegenerationRetinal dysplasiaRetinal DysplasiaTumor Suppressor Protein p53Primordial dwarfismDNA DamageDisease Models & Mechanisms
researchProduct