Search results for "ONTOLOGY"

showing 10 items of 5542 documents

Les Pseudoperisphinctinae (Ammonitina, Perisphinctidae) de l'horizon à Leckenbyi (Callovien supérieur, zone à Athleta) de Montreuil-Bellay (Maine-et-…

2008

International audience; Dans la région de Montreuil-Bellay (Maine-et-Loire), de nombreuses coupes ont été réalisées au passage Callovien moyen-Callovien supérieur. Le premier banc attribué au Callovien supérieur a été daté de l'horizon à Leckenbyi. Il a fourni une très importante faune ammonitique (N=3125), dans laquelle les Perisphinctidae représentent 51% de l'effectif. À côté de formes plus ou moins bien connues comme Pseudopeltoceras leckenbyi (Bean), Orionoides pseudorion (Waagen), Subgrossouvria famulum (Bean) et S. crassa Gérard et Contaut, on trouve une espèce qui n'a jamais été ni décrite ni figurée : cette espèce fait l'objet du présent article. Choffatia isabellae n. sp. se disti…

new speciesMontreuil-BellayPerisphinctidaeStratigraphyespèce nouvellePaleontologyGeologydimorphisme sexuelAthleta zonesexual dimorphismUpper Callovianhorizon à Leckenbyi[SDU.STU.PG] Sciences of the Universe [physics]/Earth Sciences/PaleontologyFrancezone à AthletaLeckenbyi horizonCallovien supérieur[ SDU.STU.PG ] Sciences of the Universe [physics]/Earth Sciences/Paleontology
researchProduct

Le petit appétit du grand âge

2018

National audience

older adultnursing home[SDV.AEN] Life Sciences [q-bio]/Food and Nutrition[SDV.MHEP.GEG] Life Sciences [q-bio]/Human health and pathology/Geriatry and gerontology[SDV.MHEP.GEG]Life Sciences [q-bio]/Human health and pathology/Geriatry and gerontologyclinical trialmalnutrition[SDV.AEN]Life Sciences [q-bio]/Food and NutritionelderlyComputingMilieux_MISCELLANEOUSsenior
researchProduct

L'alimentation des seniors : bien manger pour bien vieillir

2022

older adultundernutritionaged[SDV.AEN] Life Sciences [q-bio]/Food and Nutrition[SDV.MHEP.GEG] Life Sciences [q-bio]/Human health and pathology/Geriatry and gerontologyfood
researchProduct

Dénutrition et alimentation des personnes âgées

2023

older peopleundernutritionaged[SDV.AEN] Life Sciences [q-bio]/Food and Nutritionnutrition[SDV.MHEP.GEG] Life Sciences [q-bio]/Human health and pathology/Geriatry and gerontologyfoodeating behaviorelderly
researchProduct

Impacto del tratamiento periodontal en el ratio rnakl/opg

2015

La reabsorción ósea es uno de los procesos con mayor transcendencia en la periodontitis. El descubrimiento del eje RANKL/RANL/0PG (receptor activador de la osteoclastogénesis) supuso un avance en la comprensión del remodelado óseos fisiológico y patológico. Los recientes estudios realizados tanto a nivel histológico como a nivel del fluido crevicular, han comprobado el aumento del ratio RANKL/OPG en los pacientes con periodontitis.Nuevos conocimientos en ésta línea aportarán información sobre la patogenia y por tanto podrían ser utilizados en el diagnóstico y tratamiento periodontal. Objetivo: Determinar el efecto del tratamiento periodontal básico (raspado y alisado radicular, junto con in…

ondontologyopgbiomarkersIrankltratamiento periodontalperiodontal treatmentratio Irankl/opgsranklcrevicular fluid
researchProduct

Towards Dynamic Ontology - Integrating Tools of Evolution and Versionning in Ontology

2010

6; International audience; Since Gruber's definition, a lot of works focused on evolution or versioning issues. Not much attention has been paid to integrated solutions which resolve both these two purposes. In this paper we present a new semantic architecture that combines versioning tools with the evolution process. This architecture called VersionGraph is integrated in the source ontology since its creation in order to make it possible to evolve and to be versioned.

ontology lifecycle[INFO.INFO-WB] Computer Science [cs]/Web[SCCO.COMP] Cognitive science/Computer sciencechange operations[ SCCO.COMP ] Cognitive science/Computer science[INFO.INFO-WB]Computer Science [cs]/Webversioning[ INFO.INFO-WB ] Computer Science [cs]/Web[SCCO.COMP]Cognitive science/Computer scienceVersiongraph
researchProduct

A route to agnosticism in mathematics

ontology philosophy of mathematics nominalismSettore M-FIL/02 - Logica E Filosofia Della Scienza
researchProduct

Envisioning Information Systems Support for Business Ecosystem Architecture Management in Public Sector

2018

Based on our research concerning Finnish national enterprise architecture (EA) adoption in long run, we discuss here how EA concept and tool are to be developed to support business ecosystem and organization design. Our research context indicates, beyond a federal government or a state one, that even a single municipality, like a city concern, can be perceived as an ecosystem of its sectoral domains, subsidiaries etc. We outline a vision of an overall ontologybased, shared EA repository for the-whole-of-government current state descriptions. We specify the central design principles and functional requirements for such a system and illustrate some potential use cases of it. The study suggest…

ontologykokonaisarkkitehtuuribusiness ecosystemontologiat (tiedonhallinta)julkinen sektoritietojärjestelmät
researchProduct

From treatment of mental disorders to the treatment of difficult life situations: A hypothesis and rationale

2023

The group-level symptom-reduction model of mental health care emphasizes predetermined treatment guidelines for those mental and social difficulties that are diagnosable as mental health disorders on the basis of predetermined diagnostic criteria. The model have produced generalizable information to support medical decision-making for symptom reduction. However, it may have also increased the reification of diagnostic labels, and in so doing medicalized and stigmatized complex human-life experiences, with a lack of attention to a range of social determinants and existential factors associated with mental health. Since symptom-reduction model can easily lose sight of essential non-technical …

open dialoguepsychiatric servicesGeneral Medicinepsychiatryelämäntilannemielenterveyspsykiatrinen hoitomielenterveyshäiriöthoitomenetelmätvaikeudetontologymielenterveyspalvelutmental healthsosioekonomiset tekijätMedical Hypotheses
researchProduct

Reliability of Frail and Barthel Tests for Detecting Frailty in Palliative Oncological Patients in a Home Hospitalization Unit: A Comparative Study.

2022

Cancer is a condition that can increase the risk of frailty. In addition, palliative oncological patients in home hospitalization can find their activities of daily living affected. The main objective was to measure the degree of frailty in the oncological population in home hospitalization comparing Barthel and Frail-VIG Indexes. This is a descriptive cross-sectional study. A sample of oncological patients in home hospitalization (n = 50) that included 27 men and 23 women were recruited, and disability due to frailty was measured using the VIG frailty index and the Barthel scale for Activities of Daily Living (ADLs). Spearman’s correlation coefficients were categorized as weak (rs &l…

palliative carePaliative careFrailtyHospitalització domiciliàriafrailty; palliative care; cancer; home care; frail-VIG indexPaleontologyCáncerCuidados en casaCuidados paliativosHome careGeneral Biochemistry Genetics and Molecular BiologyOncologíaSpace and Planetary ScienceFrail-VIG indexTractament pal·liatiuÍndice VIG de vulnerabilidadEnfermeríaCàncer Pacientshuman activitiesVulnerabilidadEcology Evolution Behavior and SystematicsCancerLife (Basel, Switzerland)
researchProduct