Search results for "OUTCOME"

showing 10 items of 5148 documents

Efficacy of an internet-based exposure treatment for flying phobia (NO-FEAR Airlines) with and without therapist guidance: a randomized controlled tr…

2019

Background Internet-based treatments appear to be a promising way to enhance the in vivo exposure approach, specifically in terms of acceptability and access to treatment. However, the literature on specific phobias is scarce, and, as far as we know, there are no studies on Flying Phobia (FP). This study aims to investigate the effectiveness of an Internet-based exposure treatment for FP (NO-FEAR Airlines) that includes exposure scenarios composed of images and sounds, versus a waiting-list control group. A secondary aim is to explore two ways of delivering NO-FEAR Airlines, with and without therapist guidance. Methods A randomized controlled trial (RCT) was conducted in which 69 participan…

AdultMalemedicine.medical_specialtylcsh:RC435-571Health BehaviorPsychological interventionSelf-helpFlying Phobialaw.inventionTreatment and control groupsFear of flying03 medical and health sciences0302 clinical medicineRandomized controlled trialPatient Education as TopiclawIntervention (counseling)lcsh:PsychiatrySurveys and Questionnairestherapist guidancemedicineSafety behaviorsHumans030212 general & internal medicineflying phobiaFlying phobiaself-helpInternetCognitive Behavioral Therapybusiness.industryinternet-based exposureFearMiddle Agedmedicine.disease030227 psychiatrySelf CarePsychiatry and Mental healthTreatment OutcomeTherapist guidancePhobic DisordersRandomized controlled trialTherapy Computer-Assistedrandomized controlled trialPhysical therapyThe InternetFemaleInternet-based exposurebusinessResearch Article
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

The role of personality disorders on drug dependence treatment outcomes following inpatient detoxification

2004

AbstractAimsThe present 6 month follow-up study was conducted to investigate the possible influence of comorbid personality disorders on drug treatment, as well as associated psychopathology and HIV-related risk behaviors outcomes.Subjects and methodsData were collected initially from a consecutive sample of 74 patients with a diagnosis of opiate abuse or dependence, admitted for inpatient detoxification.ResultDuring intake, 80.9% of patients reported at least one HIV-related risk behavior in the previous 6 months. Not using condoms during sexual intercourse was the most common and the only risk behavior that showed a statistically significant reduction over the follow-up period. A total of…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectPsychological interventionHIV InfectionsComorbidityPersonality Disorders03 medical and health sciencesRisk-Taking0302 clinical medicineAcquired immunodeficiency syndrome (AIDS)medicineHumansPersonalityPsychiatrymedia_commonAddictionOpioid-Related Disordersmedicine.diseasePersonality disorders030227 psychiatryHospitalizationPsychiatry and Mental healthSexual intercourseTreatment OutcomeFemaleOpiatePsychologyRisk Reduction Behavior030217 neurology & neurosurgeryFollow-Up StudiesPsychopathologyEuropean Psychiatry
researchProduct

Residual vein thrombosis to establish duration of anticoagulation after a first episode of deep vein thrombosis: the Duration of Anticoagulation base…

2008

Abstract Residual vein thrombosis (RVT) indicates a prothrombotic state and is useful for evaluating the optimal duration of oral anticoagulant treatment (OAT). Patients with a first episode of deep vein thrombosis, treated with OAT for 3 months, were managed according to RVT findings. Those with RVT were randomized to either stop or continue anticoagulants for 9 additional months, whereas in those without RVT, OAT was stopped. Outcomes were recurrent venous thromboembolism and/or major bleeding. Residual thrombosis was detected in 180 (69.8%) of 258 patients; recurrent events occurred in 27.2% of those who discontinued (25/92; 15.2% person-years) and 19.3% of those who continued OAT (17/88…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep veinImmunologyHemorrhageBiochemistryDrug Administration ScheduleSettore MED/15 - Malattie Del SangueDeep vein thrombosioral anticoagulantSecondary PreventionmedicineHumansAgedUltrasonographyVenous ThrombosisFirst episoderesidual vein thrombosisVascular diseasebusiness.industryAnticoagulantHazard ratioAnticoagulantsCell BiologyHematologyMiddle Agedmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareThrombosisConfidence intervalSurgeryVenous thrombosisTreatment Outcomemedicine.anatomical_structureFemalebusinessBlood
researchProduct

The incidence of heparin-induced thrombocytopenia in medical patients treated with low-molecular-weight heparin: a prospective cohort study.

2005

AbstractIn contrast with extensive documentation in patients treated with unfractionated heparin (UFH), the incidence of heparin-induced thrombocytopenia (HIT) in medical patients receiving low-molecular-weight heparin (LMWH) is less well defined. In a prospective cohort study, the platelet count was monitored in 1754 consecutive patients referred to 17 medical centers and treated with LMWH for prophylaxis or treatment of thromboembolic disorders. The diagnosis of HIT was accepted in case of a platelet drop of at least 50%, the absence of obvious explanations for thrombocytopenia, and the demonstration of heparin-dependent IgG antibodies. HIT developed in 14 patients (0.80%; 95% CI, 0.43%-1…

AdultMalemedicine.medical_specialtymedicine.drug_classImmunologyLow molecular weight heparinheparinPlatelet Factor 4BiochemistryCohort StudiesRisk FactorsHeparin-induced thrombocytopeniaInternal medicinemedicineHumansProspective StudiesProspective cohort studyAgedAged 80 and overbusiness.industryIncidence (epidemiology)IncidenceCell BiologyHematologyHeparinHeparin Low-Molecular-WeightMiddle Agedmedicine.diseaseThrombocytopeniaSurgeryClinical trialTreatment OutcomeFemaleComplicationbusinessCohort studymedicine.drugBlood
researchProduct

Efficacy and Safety of Subcutaneous Belimumab in Anti–Double-Stranded DNA–Positive, Hypocomplementemic Patients With Systemic Lupus Erythematosus

2018

Objective: To investigate the efficacy and safety of belimumab, a human immunoglobulin monoclonal antibody against B lymphocyte stimulator, in a subset of patients with systemic lupus erythematosus (SLE) who were hypocomplementemic (C3 <90 mg/dl and/or C4 <10 mg/dl) and anti–double-stranded DNA (anti-dsDNA) positive (≥30 IU/ml) at baseline. Methods: In this phase III, double-blind, placebo-controlled study (BEL112341; ClinicalTrials.gov identifier: NCT01484496), patients with moderate to severe SLE (Safety of Estrogens in Lupus Erythematosus National Assessment version of the Systemic Lupus Erythematosus Disease Activity Index [SELENA–SLEDAI] score ≥8) were randomized (2:1) to receive weekl…

AdultMalemedicine.medical_specialtymedicine.drug_classInjections SubcutaneousPopulationImmunologyPlaceboAntibodies Monoclonal HumanizedGastroenterologySystemic Lupus ErythematosusSeverity of Illness Index03 medical and health sciences0302 clinical medicineDouble-Blind MethodRheumatologyInternal medicinemedicineHumansLupus Erythematosus SystemicImmunology and Allergy030212 general & internal medicineeducationAdverse effectskin and connective tissue diseases030203 arthritis & rheumatologyeducation.field_of_studyLupus erythematosusIntention-to-treat analysisbusiness.industryComplement C3DNAmedicine.diseaseBelimumabRheumatologyIntention to Treat AnalysisTreatment OutcomeAntibodies AntinuclearImmunology and Allergy; Rheumatology; ImmunologyCorticosteroidOriginal ArticleFemalebusinessmedicine.drug
researchProduct

The prevalence of post-thyroidectomy chronic asthenia: a prospective cohort study

2017

Chronic asthenia (CA) is complained by some patients that have undergone thyroid surgery. We evaluate its impact in patients undergoing unilateral or bilateral thyroidectomy, the trend during a 1-year follow-up, and the possible risk factors. A prospective, cohort study was carried out on 263 patients scheduled for thyroidectomy from 2012 and 2014. Exclusion criteria were as follows: Graves’ disease, malignancies requiring radioiodine therapy, post-surgical hypoparathyroidism, laryngeal nerve palsy, abnormal pre- and post-operative thyroid hormone levels, and BMI outside the normal range. Demographics; smoking and alcoholism addiction; cardiac, pulmonary, renal, and hepatic failure; diabete…

AdultMalemedicine.medical_specialtymedicine.medical_treatment030209 endocrinology & metabolismCohort Studies03 medical and health sciencesPostoperative Complications0302 clinical medicineRisk FactorsInternal medicineHemithyroidectomyPrevalencemedicineHumansRisk factorTotal thyroidectomyProspective cohort studyFatigueDepression (differential diagnoses)AgedChronic astheniabusiness.industryThyroidectomyMiddle Agedmedicine.diseaseThyroid DiseasesSurgeryCardiac surgerySettore MED/18 - Chirurgia GeneraleTreatment OutcomeHypoparathyroidismAsthenia030220 oncology & carcinogenesisChronic DiseaseThyroidectomyFemaleSurgerybusinessAbdominal surgeryCohort studyChronic asthenia; Fatigue; Hemithyroidectomy; Total thyroidectomy; Surgery
researchProduct

Treatment of psoriasis with the chimeric monoclonal antibody against tumor necrosis factor alpha, infliximab.

2002

Abstract Background: Psoriatic skin lesions in patients with Crohn's disease or psoriatic arthritis have shown improvement during infliximab treatment. Objective: The purpose of our study was to systematically assess the effects of infliximab in patients with psoriatic skin lesions. Methods: Eight patients with severe psoriasis were enrolled in an open-label clinical trial. Patients received infliximab, 5 mg/kg, intravenously at weeks 0, 2, and 6. The Psoriasis Area and Severity Index (PASI) was used to monitor disease activity at weeks 0, 2, 4, 6, 8, 10, and 14. Week 10 was the end point of the treatment phase; week 14 was the follow-up end point. Pruritus was assessed on a scale of 0 to 3…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentAcanthosisDermatologyGastroenterologySeverity of Illness IndexPsoriatic arthritisPsoriasis Area and Severity IndexInternal medicinePsoriasisBiopsymedicineHumansPsoriasisAdverse effectInfusions IntravenousChemotherapymedicine.diagnostic_testbusiness.industryTumor Necrosis Factor-alphaAntibodies MonoclonalMiddle Agedmedicine.diseaseInfliximabInfliximabSurgeryTreatment OutcomeFemaleDermatologic Agentsbusinessmedicine.drugJournal of the American Academy of Dermatology
researchProduct

Implants in free fibula flap supporting dental rehabilitation - Implant and peri-implant related outcomes of a randomized clinical trial.

2016

Abstract Objectives The objective of this study was to assess the difference in success rates of implants when using two or four implant-supported-overdentures following segmental mandibular reconstruction with fibula free flap. Methods and designs This prospective, parallel designed, randomized clinical study was conducted with 1:1 ratio. At baseline, all participants already had segmental reconstruction of mandible with free fibula flap. The participants were randomized into two groups: Group-I received implant-supported-overdentures on two tissue-level implants and Group-II received implant-supported-overdentures on four tissue-level implants. Success rates of the implants were evaluated…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentAlveolar Bone LossDentistryFree flapFree Tissue Flapslaw.inventionDental Prosthesis Retention03 medical and health sciences0302 clinical medicineRandomized controlled triallawmedicineHumansFibulaRehabilitationbusiness.industryDental Implantation EndosseousMandibleSoft tissue030206 dentistryHyperplasiamedicine.diseaseDenture OverlaySurgeryTreatment OutcomeOtorhinolaryngologyFibula030220 oncology & carcinogenesisSurgeryFemaleImplantDental Prosthesis Implant-SupportedOral SurgerybusinessJournal of cranio-maxillo-facial surgery : official publication of the European Association for Cranio-Maxillo-Facial Surgery
researchProduct

Clinical and radiological features of hybrid surgery in multilevel cervical degenerative disc disease.

2015

Purpose: Although several studies have established the safety and efficacy of cervical disc arthroplasty (CDA) as compared to anterior cervical discectomy and fusion (ACDF), few studies have investigated the role of hybrid surgery (HS) that incorporates ACDF and CDA techniques in multilevel cervical degenerative disc disease (MLCDDD). Methods: This prospective study enrolled patients with MLCDDD who underwent HS. Twenty consecutive patients who underwent HS were compared with patients who underwent ACDF and CDA at the same level of surgery. Patients were followed up for more than 2 years. Intraoperative parameters, clinical features and outcome scores were recorded. Radiological assessments…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentAnterior cervical discectomy and fusionIntervertebral Disc DegenerationFunctional scoreArtificial disc replacementDegenerative disc diseaselaw.inventionFollow-Up StudieRandomized controlled triallawmedicineHumansOrthopedics and Sports MedicineProspective StudiesProspective cohort studyAgedbusiness.industryAnterior cervical discectomy fusionMedicine (all)Middle Agedmedicine.diseaseArthroplastySurgeryProspective Studiemedicine.anatomical_structureSpinal FusionTreatment OutcomeSpinal fusionCervical VertebraeSurgeryFemalebusinessRange of motionHybrid surgeryCervical vertebraeHumanDiskectomyFollow-Up StudiesEuropean spine journal : official publication of the European Spine Society, the European Spinal Deformity Society, and the European Section of the Cervical Spine Research Society
researchProduct