Search results for "Observation"

showing 10 items of 1586 documents

Interdisciplinary treatment of diabetic foot wounds in the elderly : Low risk of amputations and mortality and good chance of being mobile with good …

2016

Aims: A major proportion of patients with diabetic foot syndrome are older than 65 years. Little is known about outcomes of these elderly patients. Methods: We analysed 245 treatment cases in an observational single-centre study for comorbidities and outcomes over a 6-month period. Results: In all, 122 patients had peripheral arterial disease which was significantly increasing with age ( n = 245, df = 1, χ2 = 23.06, p ⩽ 0.0001). Increasing age correlated positively with decreasing rate of revascularisations ( n = 122, df = 1, χ2 = 4.23, p = 0.039). In total, 23 (9.3%) patients died in the observation period. In-hospital mortality was 2.8%, percentage of major amputations 2.8%. In the invasi…

AdultMalemedicine.medical_specialtyTime FactorsArterial diseaseEndocrinology Diabetes and MetabolismObservation periodMedizin030209 endocrinology & metabolismComorbidity030204 cardiovascular system & hematologyAmputation Surgical03 medical and health sciences0302 clinical medicineQuality of lifeRisk FactorsGermanyDiabetes mellitusInternal medicineInternal MedicinemedicineHumansHospital MortalityMobility LimitationAgedRetrospective StudiesAged 80 and overPatient Care TeamWound HealingInterdisciplinary treatmentbusiness.industryEndovascular ProceduresAge FactorsRecovery of FunctionMiddle AgedLimb Salvagemedicine.diseaseDiabetic footDiabetic FootSurgeryTreatment OutcomeQuality of LifeFemaleObservational studyCardiology and Cardiovascular MedicinebusinessVascular Surgical Procedures
researchProduct

Adalimumab efficacy in enteropathic spondyloarthritis: A 12-mo observational multidisciplinary study

2017

AIM To report adalimumab (Ada) efficacy on articular-gastrointestinal disease and health-related quality of life (HRQoL) in patients with enteropathic spondyloarthritis (ES). METHODS A cohort of 52 patients with ES was evaluated in the departments of gastroenterology and internal medicine. At baseline, all patients underwent assessment by an integrated gastro-rheumatologic evaluation of articular and gastrointestinal activity, as well patient reported outcomes (PROs) of the HRQoL questionnaires. After this integrated evaluation and following a specific working flowchart, the Ada anti-tumor necrosis factor (TNF)-inhibitor was assigned to a cohort of 30 patients and its clinical efficacy was …

AdultMalemedicine.medical_specialtyTime FactorsTumor necrosis factor-inhibitorMultidisciplinary studyObservational StudyInflammatory bowel diseasesInflammatory bowel diseaseWorkflowEnteropathic spondyloarthriti03 medical and health sciences0302 clinical medicineCrohn DiseaseClinimetric assessmentInternal medicineSpondylarthritisTumor necrosis factor-inhibitorsAdalimumabHumansMedicinePatient Reported Outcome MeasuresPatient reported outcomes030203 arthritis & rheumatologyBiological ProductsTumor Necrosis Factor-alphabusiness.industryRemission InductionAdalimumabGastroenterologyInflammatory Bowel DiseasesGeneral MedicineMiddle AgedPatient reported outcomeEnteropathic spondyloarthritisClinimetric assessment; Enteropathic spondyloarthritis; Inflammatory bowel diseases; Multidisciplinary evaluation; Patient reported outcomes; Tumor necrosis factor-inhibitors; GastroenterologyTreatment OutcomeMultidisciplinary evaluationAntirheumatic AgentsCritical PathwaysQuality of LifeColitis UlcerativeFemale030211 gastroenterology & hepatologyObservational studybusinessmedicine.drug
researchProduct

Do equilibrium constraints modulate postural reaction when viewing imbalance?

2011

Abstract Action observation and action execution are tightly coupled on a neurophysiological and a behavioral level, such that visually perceiving an action can contaminate simultaneous and subsequent action execution. More specifically, observing a model in postural disequilibrium was shown to induce an increase in observers’ body sway. Here we reciprocally questioned the role of observers’ motor system in the contagion process by comparing participants’ body sway when watching displays of antero-posterior vs. lateral imbalance. Indeed, during upright standing, biomechanical constraints differ along the antero-posterior (A-P) and medio-lateral (M-L) axes; hence an impact of observers’ post…

AdultMalemedicine.medical_specialtyVisual perceptionAdolescentCognitive NeuroscienceExperimental and Cognitive PsychologyPhysical medicine and rehabilitationArts and Humanities (miscellaneous)Center of pressure (terrestrial locomotion)Motor systemDevelopmental and Educational PsychologymedicinePsychophysicsHumansPostural BalanceNeurophysiologyImitative BehaviorBody swayBiomechanical PhenomenaNeuropsychology and Physiological PsychologyAction observationVisual PerceptionFemaleFrancePsychologySocial psychologyPsychomotor Performance
researchProduct

Association between a comprehensive smoking ban and hospitalization for acute myocardial infarction: An observational study in the Autonomous Communi…

2020

Objective: To assess the association between a comprehensive smoking ban and hospitalization rates for acute myocardial infarction (AMI). Methods: An observational study was conducted to assess changes in hospital admission rates for AMI in the Autonomous Community of Valencia, Spain (population 5 million), during the period 1995-2013. Law 28/2005 prohibited smoking in all enclosed spaces (public and private), and Law 42/2010 extended the ban to bars and restaurants as well as children's playgrounds and access areas of schools and hospitals. Data on hospital admissions were obtained from the Hospital Discharge Database (CMBD) of the Autonomous Community. Annual hospital admission rates per …

AdultMalemedicine.medical_specialtylcsh:Diseases of the circulatory (Cardiovascular) systemPopulationEnfarte do miocárdio/prevenção e controloMyocardial InfarctionAdmissão de doentes03 medical and health sciencesYoung Adult0302 clinical medicineCessação tabágica/legislação e jurisprudênciaPolítica de saúdeHealth careSocietal perspectivemedicineHumans030212 general & internal medicineMyocardial infarctioneducationhealth care economics and organizationsGeneral Environmental ScienceAgedAged 80 and overeducation.field_of_studybusiness.industryHospital discharge databaseMiddle Agedmedicine.diseaseHospitalizationSmoke-Free Policy030228 respiratory systemTabagismo/prevenção e controloSpainlcsh:RC666-701Hospital admissionEmergency medicineGeneral Earth and Planetary SciencesObservational studyFemaleSmoking banCardiology and Cardiovascular MedicinebusinessRevista Portuguesa de Cardiologia
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Antibiotic prophylaxis habits in dental implant surgery among dentists in Spain. A cross-sectional survey

2018

Background The use of antibiotics to prevent dental implant failures and postoperative infections remains a controversial issue. The objectives of this study were to assess the current antibiotic prescribing patterns and antibiotic prescribing frequency of dentists in Biscay (Spain) in conjunction with routine dental implant surgery among healthy patients and to determine whether any consensus has been reached by such practitioners and last published evidence was being followed. Material and Methods Observational cross-sectional study: electronic survey. This study was reported according to the STROBE guidelines. This anonymous questionnaire contained open-ended and close-ended questions. A…

AdultMalemedicine.medical_specialtymedicine.drug_classCross-sectional studymedicine.medical_treatmentAntibioticsDrug Prescriptions03 medical and health sciencesYoung Adult0302 clinical medicineInternal medicinemedicineHumans030212 general & internal medicineAntibiotic prophylaxisMedical prescriptionDental implantGeneral DentistryAgedPractice Patterns Dentists'Response rate (survey)business.industryResearch030206 dentistryAntibiotic ProphylaxisMiddle Aged:CIENCIAS MÉDICAS [UNESCO]Surgery OralConfidence intervalDental ImplantationCross-Sectional StudiesOtorhinolaryngologySpainHealth Care SurveysUNESCO::CIENCIAS MÉDICASSurgeryObservational studyFemaleOral SurgerybusinessMedicina Oral, Patología Oral y Cirugía Bucal
researchProduct

Prescription patterns and appropriateness of NSAID therapy according to gastrointestinal risk and cardiovascular history in patients with diagnoses o…

2011

Abstract Background Prescription of non-steroidal anti-inflammatory drugs (NSAIDs) should be based on the assessment of both gastrointestinal (GI) and cardiovascular (CV) risk for the individual patient. We aimed to assess the GI/CV risk profile and the pharmacological management of patients with osteoarthritis (OA) in clinical practice. Methods We conducted a cross-sectional, multicentre, observational study of consecutive OA patients that visited 1,760 doctors throughout the Spanish National Health System (NHS) in a single day. The presence of GI risk factors, CV histories, hypertension and current pharmacological treatments was recorded. Results Of the 60,868 patients, 17,105 had a diagn…

AdultMalemedicine.medical_specialtymedicine.drug_classGastrointestinal DiseasesPopulationProton-pump inhibitorlcsh:MedicineOsteoarthritisRisk AssessmentInternal medicineOsteoarthritisMedicineHumansProspective StudiesRisk factorMedical diagnosisMedical prescriptioneducationAgedAged 80 and overMedicine(all)education.field_of_studyCardiovascular Historybusiness.industrylcsh:RAnti-Inflammatory Agents Non-SteroidalGeneral MedicineMiddle Agedmedicine.diseaseDrug UtilizationCross-Sectional StudiesPrescriptionsCardiovascular DiseasesSpainPhysical therapyObservational studyFemaleGuideline AdherencebusinessResearch ArticleBMC Medicine
researchProduct

[Metabolic syndrome in patients with coronary heart disease. Results of using different diagnostic criteria].

2004

A unified definition of metabolic syndrome, considered a common feature of cardiovascular risk, is lacking. The aim of this study was to compare the prevalence of this syndrome in patients with ischemic heart disease using two diagnostic criteria: the European Group of Resistance to Insulin and the National Cholesterol Education Program. We designed an observational, cross-sectional study of the factors that make up metabolic syndrome in subjects diagnosed with coronary heart disease. A total of 169 patients aged 35 to 79 years were studied (129 men and 40 women). With the European group criterion the percentage of patients with metabolic syndrome was 43.7%, whereas the American group crite…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentCoronary DiseaseDiseaseDiabetes mellitusInternal medicineMedicineHumansNational Cholesterol Education ProgramAgedMetabolic Syndromebusiness.industryInsulinGeneral MedicineMiddle Agedmedicine.diseaseObesityCoronary heart diseaseCross-Sectional StudiesCardiologyObservational studyFemaleMetabolic syndromebusinessBlood Chemical AnalysisRevista espanola de cardiologia
researchProduct

Patient and physician views on the quality of care in inflammatory bowel disease: Results from SOLUTION-1, a prospective IG-IBD study

2014

Remarkable differences in quality of care (QoC) might be observed in different countries, affecting quality of life of inflammatory bowel disease (IBD) patients. The aim of this study was to assess patient and physician perceptions of the QoC in Italy.A multicentre observational study on the quality of care in IBD (SOLUTION-1) was conducted in 36 IG-IBD (Italian Group for Inflammatory Bowel Disease) centres in Italy. The QUOTE-IBD (Quality of Care Through the Patient's Eyes) questionnaire was administered to IBD patients and to the attending physicians. The Quality Impact (QI) score summarises the QUOTE-IBD questionnaire, and a QI9 is considered satisfactory.Nine-hundred-ninety-two patients…

AdultMalemedicine.medical_specialtyquality impact score; quote-ibd; quality of careAdolescentAttitude of Health PersonnelQuality impact score; Quality of care; QUOTE-IBD; Adolescent; Adult; Aged; Aged 80 and over; Attitude of Health Personnel; Clinical Competence; Continuity of Patient Care; Female; Humans; Inflammatory Bowel Diseases; Italy; Male; Middle Aged; Patient Education as Topic; Patient Satisfaction; Professional Autonomy; Prospective Studies; Surveys and Questionnaires; Young Adult; Quality of Health Care; Medicine (all)Quality impact scoreGastroenterologyInflammatory bowel diseaseYoung AdultQUOTE-IBDPatient Education as TopicSurveys and QuestionnairesInternal medicineHealth care80 and overPhysician perceptionHumansMedicineProfessional AutonomyPharmaceutical SolutionsProspective StudiesQuality of careCompetence (human resources)AgedQuality of Health CareAged 80 and overbusiness.industryMedicine (all)Quality of careGastroenterologyQuality impact score; Quality of care; QUOTE-IBD; GastroenterologyGeneral MedicineContinuity of Patient CareMiddle AgedInflammatory Bowel Diseasesmedicine.diseasedigestive system diseasesItalyPatient SatisfactionFamily medicineFemaleContinuity of careObservational studyClinical CompetencebusinessJournal of Crohn's and Colitis
researchProduct

Pandemic influenza A (H1N1) infection in pregnant and nonpregnant women in Spain (2009-2010)

2014

The present study aimed to compare the main features of infection with pandemic influenza A virus in pregnant and nonpregnant women admitted to hospitals in Spain during the first waves of the 2009-2010 influenza pandemic. This was a prospective (November 2009 to June 2010), multicenter observational study. All cases were women of reproductive age who had not been vaccinated against seasonal or pandemic influenza A. Influenza infection was confirmed by reverse transcription-polymerase chain reaction (RT-PCR). The sociodemographic and clinical data of all cases were reviewed. A total of 219 inpatients, including 49 pregnant women and 170 nonpregnant women, were enrolled in the study upon adm…

AdultMicrobiology (medical)medicine.medical_specialtyAdolescentmedicine.drug_classAntibioticsDonesReproductive ageInfluenzavirusVirusYoung AdultEmbarassadesInfluenza A Virus H1N1 SubtypePregnancyInternal medicineInfluenza HumanmedicineHumansInfluenza virusesWomenPregnancy Complications InfectiousPandemicsRespiratory distressbusiness.industryPregnant womenPandemic influenzaGeneral MedicineInfluenza pandemicInfectious DiseasesIncreased riskSpainCase-Control StudiesFemaleObservational studybusiness
researchProduct