Search results for "Observational study"

showing 10 items of 776 documents

HepaDisk – A new quality of life questionnaire for HCV patients

2019

Abstract Background Since most patients with hepatitis C virus (HCV) infection now receive treatment irrespective of liver disease severity, special attention to patient quality of life (QoL), including psycho-social aspects, is required. No QoL questionnaire is specific for patients with HCV. Aims To develop and validate a short Italian questionnaire (HepaDisk) assessing the QoL of patients affected by HCV with intuitive graphic results that is understandable by patients and physicians. Methods A questionnaire, drafted by a steering committee, underwent a Delphi survey. A multicenter, observational study was conducted to validate the developed HepaDisk versus other tools (CLDQ-I, SF-36, WP…

AdultMalemedicine.medical_specialtySettore MED/09 - Medicina InternaPsychometricsgastroenterologyDiseaseSeverity of Illness IndexCorrelation03 medical and health sciencesLiver disease0302 clinical medicineQuality of lifeDisease severityCronbach's alphaSurveys and QuestionnairesInternal medicinemedicineHumansAgedRank correlationAged 80 and overbusiness.industryBurden of diseaseReproducibility of Resultspsychometric validationMiddle Agedmedicine.diseaseHepatitis CPsychometric validationburden of disease; hcv; pro development; psychometric validation; hepatology; gastroenterologyItaly030220 oncology & carcinogenesishepatologyHCVPRO developmentQuality of LifeFemale030211 gastroenterology & hepatologyObservational studybusiness
researchProduct

Incidence of non-melanoma skin cancer in patients treated with psoralen and ultraviolet A therapy.

2019

Abstract Introduction Studies reporting incidences of non-melanoma skin cancer (NMSC) are heterogeneous, depend on the geographic area of the studied population and are often short-term. The aim of this study is to determine the incidence of NMSC in patients treated with oral PUVA therapy in the Mediterranean area. Material and methods A retrospective, observational study was carried out with a sample of 234 patients treated with systemic PUVA between 1982 and 1996, carrying out a historical follow-up until May 2017. The incidence density rate of CCNM (crude and adjusted) was calculated by direct standardisation. The incidence of CCNM was compared with that reported in the general populatio…

AdultMalemedicine.medical_specialtySkin Neoplasmsmedicine.medical_treatmentPopulation03 medical and health sciences0302 clinical medicinemedicineCarcinomaHumansBasal cell carcinoma030212 general & internal medicineeducationPUVA Therapyeducation.field_of_studybusiness.industryIncidence (epidemiology)IncidenceAge FactorsMiddle Agedmedicine.diseaseDermatologyEpidermoid carcinomaCarcinoma Basal CellPUVA therapyCarcinoma Squamous CellObservational studyFemaleSkin cancerbusinessMedicina clinica
researchProduct

Resource utilization and productivity loss in persons with spina bifida—an observational study of patients in a tertiary urology clinic in Germany.

2014

Background and purpose To investigate resource use and burden associated with spina bifida (SB) in Germany. Methods A questionnaire was used to obtain information on SB-related healthcare resource use and assistive technologies used for the last 1 and 10 years. Individuals with SB were recruited at a tertiary specialist clinic. To participate, persons with SB required the cognitive ability to respond or a caregiver to answer questions on their behalf. They could use personal medical charts or other records to answer. The analyses included assessment of frequency and extent of resource use for both time frames. Results Data on 88 persons with a diagnosis of SB were collected (44% female). Du…

AdultMalemedicine.medical_specialtyTertiary Care CentersCost of IllnessGermanyHealth caremedicineHumansSpinal DysraphismHospital daysbusiness.industrySpina bifidaHealth Servicesmedicine.diseaseSelf-Help DevicesHospitalizationNeurologyPhysical therapyUrology clinicResource useObservational studyFemaleNeurology (clinical)businessHealthcare providersResource utilizationEuropean journal of neurology
researchProduct

Short-term effectiveness of golimumab for ulcerative colitis: Observational multicenter study

2016

AIM To evaluate the real-world effectiveness of golimumab in ulcerative colitis (UC) and to identify predictors of response. METHODS We conducted an observational, prospective and multi-center study in UC patients treated with golimumab, from September 2014 to September 2015. Clinical activity was assessed at wk 0 and 14 with the physician' s global clinical assessment (PGA) and the partial Mayo score. Colonoscopies and blood tests were performed, following daily-practice clinical criteria, and the results were recorded in an SPSS database. RESULTS Thirty-three consecutive patients with moderately to severely active UC were included. Among them, 54.5% were female and 42 years was the averag…

AdultMalemedicine.medical_specialtyTime FactorsAnti-Inflammatory AgentsObservational StudySeverity of Illness IndexGolimumab03 medical and health sciences0302 clinical medicineGastrointestinal AgentsAdrenal Cortex HormonesInternal medicineHumansMedicineProspective StudiesTumor Necrosis Factor-alphabusiness.industryRemission InductionGastroenterologyAntibodies MonoclonalColonoscopyGeneral MedicineMiddle Agedmedicine.diseaseReal-life resultsUlcerative colitisdigestive system diseasesGolimumabTreatment OutcomeMulticenter studyUlcerative colitisSpain030220 oncology & carcinogenesisColitis UlcerativeDrug Therapy CombinationFemale030211 gastroenterology & hepatologyObservational studybusinessmedicine.drug
researchProduct

Interdisciplinary treatment of diabetic foot wounds in the elderly : Low risk of amputations and mortality and good chance of being mobile with good …

2016

Aims: A major proportion of patients with diabetic foot syndrome are older than 65 years. Little is known about outcomes of these elderly patients. Methods: We analysed 245 treatment cases in an observational single-centre study for comorbidities and outcomes over a 6-month period. Results: In all, 122 patients had peripheral arterial disease which was significantly increasing with age ( n = 245, df = 1, χ2 = 23.06, p ⩽ 0.0001). Increasing age correlated positively with decreasing rate of revascularisations ( n = 122, df = 1, χ2 = 4.23, p = 0.039). In total, 23 (9.3%) patients died in the observation period. In-hospital mortality was 2.8%, percentage of major amputations 2.8%. In the invasi…

AdultMalemedicine.medical_specialtyTime FactorsArterial diseaseEndocrinology Diabetes and MetabolismObservation periodMedizin030209 endocrinology & metabolismComorbidity030204 cardiovascular system & hematologyAmputation Surgical03 medical and health sciences0302 clinical medicineQuality of lifeRisk FactorsGermanyDiabetes mellitusInternal medicineInternal MedicinemedicineHumansHospital MortalityMobility LimitationAgedRetrospective StudiesAged 80 and overPatient Care TeamWound HealingInterdisciplinary treatmentbusiness.industryEndovascular ProceduresAge FactorsRecovery of FunctionMiddle AgedLimb Salvagemedicine.diseaseDiabetic footDiabetic FootSurgeryTreatment OutcomeQuality of LifeFemaleObservational studyCardiology and Cardiovascular MedicinebusinessVascular Surgical Procedures
researchProduct

Adalimumab efficacy in enteropathic spondyloarthritis: A 12-mo observational multidisciplinary study

2017

AIM To report adalimumab (Ada) efficacy on articular-gastrointestinal disease and health-related quality of life (HRQoL) in patients with enteropathic spondyloarthritis (ES). METHODS A cohort of 52 patients with ES was evaluated in the departments of gastroenterology and internal medicine. At baseline, all patients underwent assessment by an integrated gastro-rheumatologic evaluation of articular and gastrointestinal activity, as well patient reported outcomes (PROs) of the HRQoL questionnaires. After this integrated evaluation and following a specific working flowchart, the Ada anti-tumor necrosis factor (TNF)-inhibitor was assigned to a cohort of 30 patients and its clinical efficacy was …

AdultMalemedicine.medical_specialtyTime FactorsTumor necrosis factor-inhibitorMultidisciplinary studyObservational StudyInflammatory bowel diseasesInflammatory bowel diseaseWorkflowEnteropathic spondyloarthriti03 medical and health sciences0302 clinical medicineCrohn DiseaseClinimetric assessmentInternal medicineSpondylarthritisTumor necrosis factor-inhibitorsAdalimumabHumansMedicinePatient Reported Outcome MeasuresPatient reported outcomes030203 arthritis & rheumatologyBiological ProductsTumor Necrosis Factor-alphabusiness.industryRemission InductionAdalimumabGastroenterologyInflammatory Bowel DiseasesGeneral MedicineMiddle AgedPatient reported outcomeEnteropathic spondyloarthritisClinimetric assessment; Enteropathic spondyloarthritis; Inflammatory bowel diseases; Multidisciplinary evaluation; Patient reported outcomes; Tumor necrosis factor-inhibitors; GastroenterologyTreatment OutcomeMultidisciplinary evaluationAntirheumatic AgentsCritical PathwaysQuality of LifeColitis UlcerativeFemale030211 gastroenterology & hepatologyObservational studybusinessmedicine.drug
researchProduct

Association between a comprehensive smoking ban and hospitalization for acute myocardial infarction: An observational study in the Autonomous Communi…

2020

Objective: To assess the association between a comprehensive smoking ban and hospitalization rates for acute myocardial infarction (AMI). Methods: An observational study was conducted to assess changes in hospital admission rates for AMI in the Autonomous Community of Valencia, Spain (population 5 million), during the period 1995-2013. Law 28/2005 prohibited smoking in all enclosed spaces (public and private), and Law 42/2010 extended the ban to bars and restaurants as well as children's playgrounds and access areas of schools and hospitals. Data on hospital admissions were obtained from the Hospital Discharge Database (CMBD) of the Autonomous Community. Annual hospital admission rates per …

AdultMalemedicine.medical_specialtylcsh:Diseases of the circulatory (Cardiovascular) systemPopulationEnfarte do miocárdio/prevenção e controloMyocardial InfarctionAdmissão de doentes03 medical and health sciencesYoung Adult0302 clinical medicineCessação tabágica/legislação e jurisprudênciaPolítica de saúdeHealth careSocietal perspectivemedicineHumans030212 general & internal medicineMyocardial infarctioneducationhealth care economics and organizationsGeneral Environmental ScienceAgedAged 80 and overeducation.field_of_studybusiness.industryHospital discharge databaseMiddle Agedmedicine.diseaseHospitalizationSmoke-Free Policy030228 respiratory systemTabagismo/prevenção e controloSpainlcsh:RC666-701Hospital admissionEmergency medicineGeneral Earth and Planetary SciencesObservational studyFemaleSmoking banCardiology and Cardiovascular MedicinebusinessRevista Portuguesa de Cardiologia
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Antibiotic prophylaxis habits in dental implant surgery among dentists in Spain. A cross-sectional survey

2018

Background The use of antibiotics to prevent dental implant failures and postoperative infections remains a controversial issue. The objectives of this study were to assess the current antibiotic prescribing patterns and antibiotic prescribing frequency of dentists in Biscay (Spain) in conjunction with routine dental implant surgery among healthy patients and to determine whether any consensus has been reached by such practitioners and last published evidence was being followed. Material and Methods Observational cross-sectional study: electronic survey. This study was reported according to the STROBE guidelines. This anonymous questionnaire contained open-ended and close-ended questions. A…

AdultMalemedicine.medical_specialtymedicine.drug_classCross-sectional studymedicine.medical_treatmentAntibioticsDrug Prescriptions03 medical and health sciencesYoung Adult0302 clinical medicineInternal medicinemedicineHumans030212 general & internal medicineAntibiotic prophylaxisMedical prescriptionDental implantGeneral DentistryAgedPractice Patterns Dentists'Response rate (survey)business.industryResearch030206 dentistryAntibiotic ProphylaxisMiddle Aged:CIENCIAS MÉDICAS [UNESCO]Surgery OralConfidence intervalDental ImplantationCross-Sectional StudiesOtorhinolaryngologySpainHealth Care SurveysUNESCO::CIENCIAS MÉDICASSurgeryObservational studyFemaleOral SurgerybusinessMedicina Oral, Patología Oral y Cirugía Bucal
researchProduct

Prescription patterns and appropriateness of NSAID therapy according to gastrointestinal risk and cardiovascular history in patients with diagnoses o…

2011

Abstract Background Prescription of non-steroidal anti-inflammatory drugs (NSAIDs) should be based on the assessment of both gastrointestinal (GI) and cardiovascular (CV) risk for the individual patient. We aimed to assess the GI/CV risk profile and the pharmacological management of patients with osteoarthritis (OA) in clinical practice. Methods We conducted a cross-sectional, multicentre, observational study of consecutive OA patients that visited 1,760 doctors throughout the Spanish National Health System (NHS) in a single day. The presence of GI risk factors, CV histories, hypertension and current pharmacological treatments was recorded. Results Of the 60,868 patients, 17,105 had a diagn…

AdultMalemedicine.medical_specialtymedicine.drug_classGastrointestinal DiseasesPopulationProton-pump inhibitorlcsh:MedicineOsteoarthritisRisk AssessmentInternal medicineOsteoarthritisMedicineHumansProspective StudiesRisk factorMedical diagnosisMedical prescriptioneducationAgedAged 80 and overMedicine(all)education.field_of_studyCardiovascular Historybusiness.industrylcsh:RAnti-Inflammatory Agents Non-SteroidalGeneral MedicineMiddle Agedmedicine.diseaseDrug UtilizationCross-Sectional StudiesPrescriptionsCardiovascular DiseasesSpainPhysical therapyObservational studyFemaleGuideline AdherencebusinessResearch ArticleBMC Medicine
researchProduct