Search results for "Ones"

showing 10 items of 7243 documents

Acute Hormonal and Force Responses to Combined Strength and Endurance Loadings in Men and Women: The “Order Effect”

2013

Purpose To examine acute responses and recovery of serum hormones and muscle force following combined strength (S) and endurance (E) loading sessions in which the order of exercises is reversed (ES vs. SE). Methods This cross-over study design included recreationally endurance trained men and women (age 21–45 years, n = 12 men n = 10 women) who performed both loadings. Maximal bilateral isometric strength (MVC), isometric rate of force development (RFD) and serum concentrations of testosterone (T), cortisol (C), growth hormone (GH), insulin-like growth factor 1 (IGF-1), binding protein 3 (IGFBP3) and sex hormone binding globulin (SHBG) were measured during and after both loadings. Results B…

AdultMalemedicine.medical_specialtyendocrineAnatomy and PhysiologyStrength trainingClinical Research DesignIGFBP3lcsh:MedicineEndocrine SystemIsometric exerciseYoung AdultSex hormone-binding globulinEndocrinologyInternal medicinemedicineHumansMuscle StrengthSports and Exercise Medicinelcsh:ScienceBiologyMusculoskeletal SystemTestosteroneHydrocortisoneMultidisciplinarySurvey ResearchCross-Over StudiesbiologyEndocrine Physiologybusiness.industrylcsh:Rconcurrent strength and endurance trainingMiddle AgedCrossover studyhormonitHormonesEndocrinologyCross-Sectional Studiesbiology.proteinBody CompositionPhysical EnduranceMedicinelcsh:QFemaleneuromuscularbusinessHormonemedicine.drugResearch ArticlePLoS ONE
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Survival trends and predictors of mortality in severe pelvic trauma: estimates from the German Pelvic Trauma Registry Initiative.

2010

Abstract Study objective To determine longitudinal trends in mortality, and the contribution of specific injury characteristics and treatment modalities to the risk of a fatal outcome after severe and complex pelvic trauma. Methods We studied 5048 patients with pelvic ring fractures enrolled in the German Pelvic Trauma Registry Initiative between 1991 and 1993, 1998 and 2000, and 2004 and 2006. Complete datasets were available for 5014 cases, including 508 complex injuries, defined as unstable fractures with severe peri-pelvic soft tissue and organ laceration. Multivariable mixed-effects logistic regression analysis was employed to evaluate the impact of demographic, injury- and treatment-a…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentAbdominal InjuriesFractures BoneYoung AdultFracture FixationLaparotomyGermanyFracture fixationEpidemiologymedicineHumansRegistriesYoung adultPelvic BonesSurvival analysisGeneral Environmental ScienceAgedbusiness.industryMultiple TraumaAccidents TrafficOdds ratioMiddle AgedVascular System InjuriesSurvival AnalysisConfidence intervalSurgeryEmergency medicineGeneral Earth and Planetary SciencesInjury Severity ScoreFemalebusinessEpidemiologic MethodsInjury
researchProduct

Impact of Gallbladder Status on the Outcome in Patients with Retained Bile Duct Stones Treated with Extracorporeal Shockwave Lithotripsy

2002

BACKGROUND AND STUDY AIMS The use of endoscopic therapy in combination with lithotripsy techniques has become increasingly common in patients with complicated common bile duct stones. In many units, although this is controversial, cholecystectomy is then performed, because of possible subsequent cholecystitis and recurrence of choledocholithiasis. The aim of this study was to investigate whether gallbladder status influences the long-term outcome in patients after extracorporeal shockwave lithotripsy (ESWL) of common bile duct stones. PATIENTS AND METHODS Recruited for the study were 120 patients with an average age of 68 years (range 28 - 86). They were selected from 137 consecutive patien…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentGallstonesLithotripsyRecurrenceRisk FactorsLithotripsymedicineHumansCholecystectomyAgedAged 80 and overCholangiopancreatography Endoscopic RetrogradeEndoscopic retrograde cholangiopancreatographyCommon bile ductmedicine.diagnostic_testbusiness.industryBile ductGallbladderGastroenterologyMiddle Agedmedicine.diseaseSurgeryTreatment Outcomemedicine.anatomical_structureElective Surgical ProceduresBiliary tractCholecystitisFemaleCholecystectomybusinessEndoscopy
researchProduct

Single-incision laparoscopic cholecystectomy: Our experience and review of literature

2016

Aim After the revolution in the surgery of gallbladder stones represented by the laparoscopic cholecystectomy, we tried a new technique that further maximize the aesthetic results and that at the same time is of easy learning for young surgeons. Patients and methods From January 2011 to December 2012 we performed at our department 320 cholecystectomy: 27 in laparotomy and 293 in laparoscopy. Of these, 88 underwent to Single Incision Laparoscopic Surgery (SILS), namely the Single Incision Laparoscopic Cholecystectomy (SILC), in recruited patients aged between 19-65 years; 56 patients were females and 32 were males. Results The laparoscopic cholecystectomy with the SILS methodology is a safe …

AdultMalemedicine.medical_specialtymedicine.medical_treatmentGallstonesUmbilical painYoung AdultLaparotomymedicineHumansCholecystectomyLaparoscopyLaparoscopic cholecystectomySingle port; Cholecystectomy; Cholecysto-choledochal lithiasis; SILSSILSAgedmedicine.diagnostic_testbusiness.industryCholecysto-choledochal lithiasiGeneral surgeryGallstonesMini-ReviewMiddle Agedmedicine.diseaseUmbilical herniaSingle incision laparoscopicCholecystectomy LaparoscopicGallstoneCholecysto-choledochal lithiasisCholecystectomyFemalebusinessSingle portHuman
researchProduct

Fluoroquinolone-induced liver injury: three new cases and a review of the literature.

2012

PURPOSE: Fluoroquinolones are popular and widely used in primary care and hospital settings. Premarketing studies showed a favourable side-effect profile. However, significant morbidity and the need for liver transplantation for acute liver failure have been reported. We reviewed the available data on liver damage linked to fluoroquinolones. METHODS: A systematic search of case reports on the MEDLINE database encompassing the years 2000-2011 was carried out. Additional references were found by a manual search of the retrieved paper. We also describe three new cases of hepatotoxicity attributable to fluoroquinolones seen at our Unit. RESULTS: Thirty-five cases were retrieved from MEDLINE (51…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentTreatment outcomePrimary careLiver transplantationfluoroquinoloneSeverity of Illness IndexSeverity of illnessMedicineHumansPharmacology (medical)Liver damageIntensive care medicinePharmacologyHepatitisLiver injurySettore MED/12 - Gastroenterologiabusiness.industryLiver failureGeneral MedicineMiddle Agedmedicine.diseaseAnti-Bacterial AgentsTreatment OutcomeItalyliver damageSettore BIO/14 - FarmacologiaFemaleDILIChemical and Drug Induced Liver InjurybusinessFluoroquinolones
researchProduct

Bone metabolism and clinical study of 44 patients with bisphosphonate-related osteonecrosis of the jaws.

2011

Osteonecrosis of the jaws is a clinical entity described and linked to treatment with bisphosphonates in 2003. Its real incidence is unknown and it could increase due to the large number of patients treated with these drugs, and its cumulative effect on the bone. State of the art knowledge regarding its etiopathogeny, clinical course and suitable treatments is limited. Objectives: To study the clinical characteristics of 44 patients with bisphosphonate-related osteonecrosis of the jaws and the state of their bone mineral metabolism: bone remodeling state, prevalence of fractures, bone mineral density study, and assessment of the different treatment strategies. Design of the Study: Observati…

AdultMalemedicine.medical_treatmentOsteoporosisDentistryOdontologíaBone and BonesBone remodelingBreast cancermedicineHumansProspective StudiesProspective cohort studyGeneral DentistryAgedBone mineralAged 80 and overBisphosphonate-associated osteonecrosis of the jawOral Medicine and Pathologybusiness.industryIncidence (epidemiology)BisphosphonateMiddle Aged:CIENCIAS MÉDICAS [UNESCO]medicine.diseaseCiencias de la saludOtorhinolaryngologyUNESCO::CIENCIAS MÉDICASSurgeryBisphosphonate-Associated Osteonecrosis of the JawFemaleResearch-ArticlebusinessMedicina oral, patologia oral y cirugia bucal
researchProduct

Prognostic factors of macrophage activation syndrome, at the time of diagnosis, in adult patients affected by autoimmune disease: Analysis of 41 case…

2016

Macrophage activation syndrome (MAS) is a rare, life-threatening disease in which early diagnosis and aggressive therapeutic strategy may improve the outcome. Due to its rarity, epidemiologic data are still lacking. Hyperferritinemia is frequently associated with MAS and might modulate the cytokine storm, which is involved in the development of multiple organ failure. In this paper, we investigated clinical data, treatments, and outcome of a homogeneous cohort of 41 adult MAS patients, complicating autoimmune rheumatic diseases. MAS-related death occurred in 17 patients (42.5%) during the follow-up, and older age and increased serum ferritin levels, at the time of diagnosis, were significan…

AdultMalemusculoskeletal diseases0301 basic medicinemedicine.medical_specialtyImmunologyAdult onset Still's disease; Hyperferritinemic syndrome; Macrophage activation syndrome; Adult; Ambulatory Care Facilities; Autoimmune Diseases; Female; Humans; Immunosuppressive Agents; Macrophage Activation Syndrome; Male; Middle Aged; Prognosis; Retrospective Studies; Treatment Outcome; Immunology and Allergy; ImmunologyDiseaseAmbulatory Care FacilitiesAutoimmune Diseases03 medical and health sciences0302 clinical medicineAdult onset Still's diseaseInternal medicineHumansImmunology and AllergyMedicineRetrospective Studies030203 arthritis & rheumatologyAutoimmune diseaseAdult patientsbusiness.industryMortality ratefungiRetrospective cohort studyMiddle AgedPrognosisHyperferritinemic syndromemedicine.diseasebody regionsSettore MED/16 - ReumatologiaTreatment Outcome030104 developmental biologyMacrophage activation syndromeMacrophage activation syndromeCohortImmunologyFemalelipids (amino acids peptides and proteins)businessCytokine stormImmunosuppressive Agentshormones hormone substitutes and hormone antagonistsAutoimmunity Reviews
researchProduct

Pandemic influenza A (H1N1) infection in pregnant and nonpregnant women in Spain (2009-2010)

2014

The present study aimed to compare the main features of infection with pandemic influenza A virus in pregnant and nonpregnant women admitted to hospitals in Spain during the first waves of the 2009-2010 influenza pandemic. This was a prospective (November 2009 to June 2010), multicenter observational study. All cases were women of reproductive age who had not been vaccinated against seasonal or pandemic influenza A. Influenza infection was confirmed by reverse transcription-polymerase chain reaction (RT-PCR). The sociodemographic and clinical data of all cases were reviewed. A total of 219 inpatients, including 49 pregnant women and 170 nonpregnant women, were enrolled in the study upon adm…

AdultMicrobiology (medical)medicine.medical_specialtyAdolescentmedicine.drug_classAntibioticsDonesReproductive ageInfluenzavirusVirusYoung AdultEmbarassadesInfluenza A Virus H1N1 SubtypePregnancyInternal medicineInfluenza HumanmedicineHumansInfluenza virusesWomenPregnancy Complications InfectiousPandemicsRespiratory distressbusiness.industryPregnant womenPandemic influenzaGeneral MedicineInfluenza pandemicInfectious DiseasesIncreased riskSpainCase-Control StudiesFemaleObservational studybusiness
researchProduct

Mind-wandering and mindfulness as mediators of the relationship between online vigilance and well-being

2018

Contains fulltext : 199030pub.pdf (Publisher’s version ) (Closed access) As mobile technology allows users to be online anywhere and at all times, a growing number of users report feeling constantly alert and preoccupied with online streams of online information and communication - a phenomenon that has recently been termed online vigilance. Despite its growing prevalence, consequences of this constant orientation toward online streams of information and communication for users' well-being are largely unclear. In the present study, we investigated whether being constantly vigilant is related to cognitive consequences in the form of increased mind-wandering and decreased mindfulness and exam…

AdultMindfulnessmindfulnessSocial Psychologymedia_common.quotation_subjectApplied psychology050801 communication & media studies050109 social psychologyYoung Adult0508 media and communicationswell-beingDistractionSurveys and QuestionnairesvigilanceMind-wanderingHumans0501 psychology and cognitive sciencesMobile technologyAttentionApplied Psychologymedia_commonWork Health and PerformanceBehaviour Change and Well-beingbusiness.industryCommunication05 social sciencesmind-wanderingGeneral MedicineAwarenesssmartphonesComputer Science ApplicationsCommunication and MediaHuman-Computer InteractionFeelingWell-beingThe InternetFemalePsychologybusinessSocial MediaVigilance (psychology)
researchProduct