Search results for "POTENT"

showing 10 items of 3940 documents

MONENSIN ENHANCES DIGOXIN-INDUCED ARRHYTHMIAS IN GUINEA-PIGS

1993

Effects of pretreatment with monensin (150 ug/kg), atenolol (0.3 mg/kg), atenolol plus monensin, verapamil (0.38 mg/kg), verapamil plus monensin, glibenclamide(0.38 mg/kg) and glibenclamide plus monensin on the dose of digoxin required to induce premature ventricular contractions (PVCS) in anaesthetized guinea-pigs were studied. Monensin reduced while atenolol increased the dose of digoxin required to produce PVCS. Atenolol plus monensin increased the dose of digoxin required to produce PVCS in presence of monensin alone. Verapamil reduces the arrhythmogenic effect of monensin on digoxin. Glibenclamide antagonises the effect of monensin on digoxin induced PVCS. From the present data it coul…

inorganic chemicalsanimal structuresDigoxinMonensinPharmacologyAtenololcarbohydrates (lipids)Guinea pigGlibenclamidechemistry.chemical_compoundchemistrymedicineCatecholamineVerapamilAction potential durationheterocyclic compoundscardiovascular diseasesmedicine.drugZagazig Journal of Pharmaceutical Sciences
researchProduct

Impact of α,β-dehydroamino acid residues on the binding abilities of di-, tri- and tetra-peptides

2000

Insertion of a dehydroamino acid residue into a sequence of di-, tri- or tetra-peptide changed considerably the binding abilities of peptide ligands towards copper(II) ions. Potentiometric and spectroscopic (EPR, UV-VIS and CD) data have shown that the amide nitrogen of the dehydroamino acid residue is more effective in co-ordination than its parent analogue. In the case of the bulky ΔPhe residue also the (Z–E) isomerisation has a critical impact on the co-ordination equilibria in the system studied.

inorganic chemicalsbiologyStereochemistryPotentiometric titrationchemistry.chemical_elementGeneral Chemistrybiology.organism_classificationCopperCatalysislaw.inventionchemistry.chemical_compoundResidue (chemistry)chemistrylawAmideMaterials ChemistryTetraElectron paramagnetic resonanceIsomerizationPeptide ligandNew Journal of Chemistry
researchProduct

Preparation of Polymeric Nanoparticles by Photo-Crosslinking of an Acryloylated Polyaspartamide in w/o Microemulsion

2004

Biodegradable polymeric nanoparticles have been prepared by UV irradiation of an acryloylated water soluble polymer by an inverse microemulsion. The starting polymer was a α,β‐poly(N‐2‐hydroxyethyl)‐D,L‐aspartamide (PHEA) partially functionalized with glycidyl methacrylate (GMA) in order to introduce reactive vinyl groups in the side chain. The PHEA‐GMA copolymer obtained (PHG) was crosslinked by UV irradiation of the inverse microemulsion prepared by mixing an aqueous solution of PHG with propylene carbonate (PC)/ethyl acetate (EtOAc) in the presence of sorbitan trioleate (SPAN 85) as surfactant. Nanoparticles obtained were characterized by FTIR spectrophotometry, transmission electron mic…

inverse microemulsionGlycidyl methacrylatePHGAqueous solutionPolymers and PlasticsChemistryOrganic ChemistryNanoparticleCondensed Matter Physicsacryloylated polyaspartamide inverse microemulsion irradiation nanoparticles PHG photo‐crosslinkingphoto-crosslinkingchemistry.chemical_compoundSettore CHIM/09 - Farmaceutico Tecnologico ApplicativoPolymer chemistryMaterials ChemistryZeta potentialSide chainCopolymernanoparticlesMicroemulsionPhysical and Theoretical ChemistryDrug carrieracryloylated polyaspartamideMacromolecular Chemistry and Physics
researchProduct

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Potential Growth and Business Cycle in the Spanish Economy: Implications for Fiscal Policy

2007

An accurately estimation of the cyclical position of an economy is a necessary condition for the success of fiscal stabilisation policies. In this paper we show that the estimation of the output gap by means of decomposing a production function produces similar results to univariate and multivariate methods, increasing their robustness and allowing us to conclude that most of the information on the economic cycle is included in the cyclical component of the unemployment rate. The results also indicate that there is reduced uncertainty about the periods when the Spanish economy has clearly been in a deep recession or in a sharp expansion. These periods have been limited and of relatively sho…

jel:E32jel:C32potential growth business cycle speed-limit policies
researchProduct

Market potential estimates in history: a survey of methods and an application to Spain, 1867-1930

2014

New Economic Geography (NEG) models stress the importance of access to demand as a key driver of the spatial and temporal distribution of economic activity (Krugman, 1991). Therefore, in order to test the theoretical predictions emanating from NEG a sound measure of accessibility is required. In line with Crafts (2005b), this paper constructs market potential estimates for Spain at the province level (NUTS3) between 1867 and 1930 using Harris’s (1954) equation. This period is particularly appealing as it was during these years that the Spanish market became integrated thanks to the fall in transport and trade costs. A number of key processes, including the substitution of traditional transp…

jel:F15jel:N74jel:N73jel:R12Market potential Economic Geography Economic History
researchProduct

Testing the Home Market Effects in a Multi-country World: The Theory

2004

We extend the two-country model by Krugman (1980) to a multi-country set-up and show that the `home-market effect' highlighted with two countries does not readily extend to such a more general setting. In particular, we prove that the most important result, namely the disproportionate causation from demand to supply, generalizes only under the fairly implausible assumption of pairwise symmetric trade costs between all countries. We argue, therefore, that the implications of product differentiation for the structure of world trade are better characterized in terms of spatial (`accessibility') and non-spatial (`attraction') effects, and we provide a theory-based specification that suggests ho…

jel:R12jel:R11jel:F12home market effect; hub effect; market potential; new trade theory; economic geography
researchProduct

Somatosensory change detection in young healthy twin males

2013

kaksosetbody compositionsomatosensory evoked potential (SEP)event-related potential (ERP)twinsmismatch negativity (MMN)tapahtumapotentiaali (ERP)somatosensorinen herätepotentiaalipoikkeavuusnegatiivisuus (MMN)kehonkoostumus
researchProduct

Ensemble deep clustering analysis for time window determination of event-related potentials

2023

Objective Cluster analysis of spatio-temporal event-related potential (ERP) data is a promising tool for exploring the measurement time window of ERPs. However, even after preprocessing, the remaining noise can result in uncertain cluster maps followed by unreliable time windows while clustering via conventional clustering methods. Methods We designed an ensemble deep clustering pipeline to determine a reliable time window for the ERP of interest from temporal concatenated grand average ERP data. The proposed pipeline includes semi-supervised deep clustering methods initialized by consensus clustering and unsupervised deep clustering methods with end-to-end architectures. Ensemble clusterin…

klusteritERP microstatesconsensus clusteringanalyysitutkimusmenetelmätensemble learningtime windowdeep clusteringevent-related potentialskognitiiviset prosessitERP
researchProduct

Automatic auditory and somatosensory brain responses in relation to cognitive abilities and physical fitness in older adults

2017

AbstractIn normal ageing, structural and functional changes in the brain lead to an altered processing of sensory stimuli and to changes in cognitive functions. The link between changes in sensory processing and cognition is not well understood, but physical fitness is suggested to be beneficial for both. We recorded event-related potentials to somatosensory and auditory stimuli in a passive change detection paradigm from 81 older and 38 young women and investigated their associations with cognitive performance. In older adults also associations to physical fitness were studied. The somatosensory mismatch response was attenuated in older adults and it associated with executive functions. So…

kognitiiviset taidotAdultAgingmedicine.medical_specialtySciencePhysical fitnessMismatch negativitySensory systemStimulus (physiology)AudiologytuntoaistiArticle050105 experimental psychologyYoung Adult03 medical and health sciencesP3asensory stimuliCognition0302 clinical medicineEvoked Potentials SomatosensorymedicineHumans0501 psychology and cognitive sciencesEffects of sleep deprivation on cognitive performanceAgedAged 80 and overMultidisciplinarybusiness.industryQ05 social sciencesRBrainElectroencephalographyCognitionMiddle Agedbrain responsesExecutive functionskuulocognitive abilitiesfyysinen kuntoikääntyminenPhysical FitnessEvoked Potentials AuditoryMedicineFemalePerceptionPsychologybusiness030217 neurology & neurosurgeryScientific Reports
researchProduct