Search results for "Plasma."

showing 10 items of 4010 documents

Novel method for determination of tritium depth profiles in metallic samples

2019

Tritium accumulation in fusion reactor materials is considered a serious radiological issue, therefore a lot of effort has been concentrated on the development of radiometric techniques. A novel method, based on gradual dissolution, for the determination of the total tritium content and its depth profiles in metallic samples is demonstrated. This method allows for the measurement of tritium in metallic samples after their exposure to a hydrogen and tritium mixture, tritium containing plasma or after irradiation with neutrons resulting in tritium formation. In this method, successive layers of metal are removed using an appropriate etching agent in the controlled regime and the amount of evo…

inorganic chemicalsfusionNuclear and High Energy PhysicsMaterials scienceNuclear engineeringchemistry.chemical_elementheliumBlanket114 Physical sciences01 natural sciences010305 fluids & plasmasblanketMetalirradiated berylliumjet0103 physical sciencespolycyclic compounds010306 general physicsHeliumbreeding blanketJet (fluid)Fusiontritiumbehaviororganic chemicalshydrogen diffusiontemperatureiter-like-wallFusion powerfirst wallberylliumCondensed Matter Physicschemistryvisual_arttransportcardiovascular systemvisual_art.visual_art_mediumdepth profileTritiumBerylliumNuclear Fusion
researchProduct

A discourse on human hair fibers and reflections on the conservation of drug molecules

1996

A gross discourse on human hair fibers and their formation is presented stressing the various interdisciplinary aspects, such as the morphological, biological, structural and biochemical data considered to be important in the field of hair analysis. An attempt is made to explain the incorporation of drug molecules during hair fiber formation by using the classical concepts of drug absorption based on lipoid theory and the pH-partition hypothesis as well as a modern biological approach on the permeability of cell membranes. In addition to the physiochemical considerations of the transport properties of a particular drug molecule such as a) the lipophilicity, which determines permeability thr…

integumentary systemStereochemistryChemistryHair analysisBiological TransportPlasma protein bindingPathology and Forensic MedicineCell membraneMembranemedicine.anatomical_structurePharmaceutical PreparationsPermeability (electromagnetism)ExtracellularBiophysicsmedicineHumansPharmacokineticsFiberDrug MonitoringIntracellularHairInternational Journal Of Legal Medicine
researchProduct

Recent highlights from GENIE v3

2021

Funder: u.s. department of energy; doi: http://dx.doi.org/10.13039/100000015

interaction: modelGeneral Physics and AstronomyFOS: Physical sciencespi: production01 natural sciencesprogrammingdark matterHigh Energy Physics - ExperimentHigh Energy Physics - Experiment (hep-ex)High Energy Physics - Phenomenology (hep-ph)0103 physical sciences[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]neutrino: scatteringGeneral Materials SciencePhysical and Theoretical Chemistry010306 general physicsnumerical calculationsneutrino: interactionneutrino nucleus: scattering010308 nuclear & particles physicsnew physicsfinal-state interactionHigh Energy Physics - Phenomenology[PHYS.HPHE]Physics [physics]/High Energy Physics - Phenomenology [hep-ph]5106 Nuclear and Plasma Physics51 Physical Sciences5107 Particle and High Energy Physics
researchProduct

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Testing of laser ablation ion source for JYFLTRAP

2015

In this work, we have constructed and tested a laser ablation ion source for JYFLTRAP Penning trap at the IGISOL (Ion Guide Isotope Separator On-line) facility. The calibration of the Penning trap parameters requires reference ions or ion clusters that have well-known masses with relatively small mass uncertainty. These ions and ion clusters can be created with certain solid targets, which contain large amounts of isotopes of reference masses and by using a laser for target ablation. In this work simulations of ion source parameters, construction, testing and improving a laser ablation ion source setup have been done. Targets with relatively large abundances of 63Cu and 65Cu, 85Rb, 87Rb, 11…

ionitPhysics::Plasma PhysicslaserablaatioPhysics::Atomic PhysicsNuclear Experiment
researchProduct

Measuring the non-linear hydrodynamic response of higher flow harmonics in Pb-Pb at sqrt(s_NN)=2.76 TeV

2017

Ultrarelativistisissa raskasionitörmäyksissä syntyvän kvarkki-gluoniplasman (QGP) dynamiikkaa on relativistisella hydrodynamiikalla kuvattu erittäin vakuuttavasti. Teorian vapaa parametri, keskimääräinen viskositeetti-entropiasuhde, on kuitenkin vielä tarkasti määrittämättä. Alustamalla törmäyksen alkutila teoreettisesti sekä soveltamalla relativistista hydrodynamiikkaa QGP:n evoluution mallintamiseen, saadaan viskositeettia tarkastelemalla käsitys QGP:n rakennesosien välisten vuorovaikutusten vahvuuksista, minkä lisäksi voidaan ymmärtää plasman evoluutioon vaikuttavia tekijöitä. Tavanomaisesti QGP:n viskositeetti määritetään vertailemalla teoreettisen alkutilan eksentrisyyden lineaarista s…

ionitflowplasma (kaasu)viscosityheavy-ionviskositeettientropia
researchProduct

ECR-ionilähteen tuottaman röntgensäteilyn simulointi

2008

ionitröntgensäteilysimulointihiukkaskiihdyttimetplasmafysiikka
researchProduct

Exploration of jet substructure using iterative declustering in pp and Pb–Pb collisions at LHC energies

2020

The ALICE collaboration at the CERN LHC reports novel measurements of jet substructure in pp collisions at $\sqrt{s}$= 7 TeV and central Pb-Pb collisions at $\sqrt{s_{\rm{NN}}}$ = 2.76 TeV. Jet substructure of track-based jets is explored via iterative declustering and grooming techniques. We present the measurement of the momentum sharing of two-prong substructure exposed via grooming, the $z_{\rm{g}}$, and its dependence on the opening angle, in both pp and Pb-Pb collisions. We also present the first measurement of the distribution of the number of branches obtained in the iterative declustering of the jet, which is interpreted as the number of its hard splittings. In Pb-Pb collisions, we…

jet substructure pp and Pb-Pb collisionsheavy ion: scattering:Kjerne- og elementærpartikkelfysikk: 431 [VDP]Physics::Instrumentation and DetectorsMonte Carlo methodPb-Pbjet quenchin; jet substructure; heavy-ion collisionshiukkasfysiikkapp and Pb-Pb collisionsnucl-expp01 natural sciencesHigh Energy Physics - ExperimentHigh Energy Physics - Experiment (hep-ex)ALICEjetscattering [p p][PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]color: coherenceNuclear Experiment (nucl-ex)Nuclear ExperimentNuclear ExperimentMonte Carlojet ; declustering ; pp ; Pb-PbPhysicsLarge Hadron ColliderPhysicsVDP::Kjerne- og elementærpartikkelfysikk: 431suppressionlcsh:QC1-999PRIRODNE ZNANOSTI. Fizika.CERN LHC Coll:Nuclear and elementary particle physics: 431 [VDP]VDP::Nuclear and elementary particle physics: 431PYTHIAdeclusteringLHCpp collisionsParticle Physics - ExperimentCoherence (physics)Nuclear and High Energy Physicsp p: scatteringAstrophysics::High Energy Astrophysical PhenomenaFOS: Physical sciences[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]114 Physical sciencesNuclear physicsheavy-ion; pp collisions; jet substructure; ALICEscattering [heavy ion]0103 physical sciencesddc:530jet substructureNuclear Physics - Experiment010306 general physicsenhancementjet quenchin010308 nuclear & particles physicshep-exheavy-ion collisionsNATURAL SCIENCES. Physics.7000 GeV-cms/nucleon 2760 GeV-cms/nucleonHeavy ion interactionQGPQuark–gluon plasmaheavy-ioncoherence [color]SubstructureHigh Energy Physics::ExperimentLHC jet QGPLHC High-Energy Physicslcsh:Physicsexperimental results
researchProduct

Laboratory formation of a scaled protostellar jet by coaligned poloidal magnetic field

2014

International audience; Although bipolar jets are seen emerging from a wide variety of astrophysical systems, the issue of their formation and morphology beyond their launching is still under study. Our scaled laboratory experiments, representative of young stellar object outflows, reveal that stable and narrow collimation of the entire flow can result from the presence of a poloidal magnetic field whose strength is consistent with observations. The laboratory plasma becomes focused with an interior cavity. This gives rise to a standing conical shock from which the jet emerges. Following simulations of the process at the full astrophysical scale, we conclude that it can also explain recentl…

jetsPhysicsJet (fluid)MultidisciplinaryShock (fluid dynamics)Young stellar objectAstrophysics::High Energy Astrophysical PhenomenaFlow (psychology)PlasmaConical surfaceAstrophysics01 natural sciencesSIMULATIONS010305 fluids & plasmasMagnetic fieldCOLLIMATION[PHYS.COND.CM-S]Physics [physics]/Condensed Matter [cond-mat]/Superconductivity [cond-mat.supr-con]DISCOVERY0103 physical sciencesDG-TAURI010303 astronomy & astrophysicsACCRETION DISCSAstrophysics::Galaxy AstrophysicsDRIVEN JETS
researchProduct

Brief interventions in counselling for nutrition and the prevalence of metabolic syndrome in primary care adult patients

2018

This research i) examined the influence of a brief nutrition-based intervention among primary care patients in changing nutrition and clinical values related to metabolic syndrome (study 1), and ii) assessed nutrition and the prevalence of metabolic syndrome and its clinical determinants among primary care patients in different sociodemographic groups (study 2). In study 1, a systematic literature review was conducted on eight databases during Sept.-Oct. 2016 with a final update in Nov. 2017. In study 2, data (n=557 for RO II-III, n=251 for RO IV-V) collected in primary care practices in Central Finland in 2006-2008 for the EVI study were analysed using Chi-Square test, GLM and Logistic Reg…

keskivartalolihavuuslifestyleobesitysystolic blood pressureelintavatdiastolinen verenpaineChi-square-testiGeneral Linear Model (GLM)nutritional behaviourLogistinen regressiobrief interventionmetabolic syndromeplasma (liquids)abdominal obesityravitsemuskäyttäytyminenglukoosiprimary caresystolinen verenpaineaineenvaihduntahäiriötmetabolic disordersCentral Finlandglucosemetabolinen oireyhtymäelämäntapainterventioninterventiolifestyle habitsperusterveydenhuoltososiodemografiset tekijätterveydenhuoltoKeski-Suomidiastolic blood pressureKliiniset arviotblood pressurevarhainen puuttuminencounsellingearly interventionverenpainenutritionplasma (neste)lihavuusdieteticssociodemographic characteristicspublic health serviceravitsemus
researchProduct