Search results for "Post"

showing 10 items of 6213 documents

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Influence of identification and preservation of pelvic autonomic nerves in rectal cancer surgery on bladder dysfunction after total mesorectal excisi…

2003

PURPOSE: Given the improvement in oncologic outcome after the introduction of total mesorectal excision for the treatment of rectal cancer, the objective of the present study was to determine the frequency of identification and preservation of the pelvic autonomic nerves and to identify a possible link between postoperative micturition disturbances and the extent of the radical resection. METHODS: Between March 1997 and December 2001, 150 patients with adenocarcinoma of the rectum (≤16 cm from the anal verge) underwent surgery, with sphincter preservation in 112 cases (74.7 percent). Sixty-three patients (42 percent) were classified as American Society of Anesthesiologists Stage III and two…

AdultMalemedicine.medical_specialtymedia_common.quotation_subjectUrinary systemRectumAdenocarcinomaUrinationNeurosurgical Proceduresmedicine.nerveHypogastric nervePostoperative ComplicationsSuperior hypogastric plexusMedicineHumansTrauma Nervous SystemUrinary Bladder NeurogenicColectomymedia_commonAgedUltrasonographyAged 80 and overUrinary bladderHypogastric Plexusbusiness.industryRectal NeoplasmsGastroenterologyHypogastric PlexusGeneral MedicineMiddle AgedTotal mesorectal excisionSurgerymedicine.anatomical_structureFemalebusinessDiseases of the colon and rectum
researchProduct

Prevention of deep vein thrombosis in neurosurgical patients: a prospective double-blind comparison of two prophylactic regimen.

1992

In a prospective, randomized, double-blind investigation of anticoagulant agents for prevention of deep vein thrombosis in patients undergoing operations at the lumbar-vertebral disc, 179 patients were randomly allocated to two groups. 87 patients received a fixed combination of low-molecular weight heparin 1,500 U-aPTT plus dihydroergotamine 0.5 mg (LMWH/DHE) once a day and additionally one injection of placebo per day, 92 patients received a fixed combination of sodium heparin 5,000 U plus dihydroergotamine 0.5 mg (HDHE) twice a day. Treatment was initiated two hours preoperatively in both groups and continued for at least seven days. Deep vein thrombosis (DVT), detected by the 125Iodine-…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep veinLow molecular weight heparinHemorrhageDihydroergotaminePostoperative ComplicationsDouble-Blind MethodRisk FactorsAntithromboticmedicineHumansProspective StudiesAgedLumbar Vertebraebusiness.industryHeparinAnticoagulantGeneral MedicineHeparinHeparin Low-Molecular-WeightMiddle AgedThrombophlebitismedicine.diseaseThrombosisSurgeryRegimenDrug Combinationsmedicine.anatomical_structureAnesthesiaSurgeryFemaleNeurology (clinical)businessDihydroergotamineIntervertebral Disc Displacementmedicine.drugNeurosurgical review
researchProduct

Case series of 589 tooth extractions in patients under bisphosphonates therapy. Proposal of a clinical protocol supported by Nd: YAG low-level laser …

2013

Objective: Trauma during dental surgery is a predisposing factor for bisphosphonates (BP)-related osteonecrosis of the jaws (BRONJ). However, about 40% of cases of BRONJ are not related to dental invasive procedures, being probably associated to endodontic or periodontal infections. Extraction of non-treatable teeth is considered a reliable choice, to improve symptoms and to reduce the risk of BRONJ. Here we report our experience of tooth extractions in patients under oral or intravenous BP therapy. Study Design: Two-hundred and seventeen patients (38 males, 179 females; mean age 68.72 ± 11.26 years, range 30 to 83 years) under BP therapy received 589 tooth extractions at the Unit of Oral M…

AdultMalemedicine.medical_specialtymedicine.drug_classmedicine.medical_treatmentOsteoporosisAntibioticsDentistryOdontologíaLasers Solid-StatePostoperative ComplicationsClinical ProtocolsmedicineHumansLow-Level Light TherapyDental CareGeneral DentistryMultiple myelomaLow level laser therapyAgedAged 80 and overBisphosphonate-associated osteonecrosis of the jawDiphosphonatesbusiness.industryMiddle Aged:CIENCIAS MÉDICAS [UNESCO]medicine.diseaseCiencias de la saludSurgerystomatognathic diseasesOtorhinolaryngologyRheumatoid arthritisDental surgeryTooth ExtractionUNESCO::CIENCIAS MÉDICASResearch-ArticleBisphosphonate-Associated Osteonecrosis of the JawFemaleSurgeryOral SurgerybusinessOral medicine
researchProduct

Early results of endovascular treatment of patients with bilateral stenoses of the internal carotid arteries using proximal protection systems at 30-…

2017

Abstract Background Although surgical endarterectomy remains the treatment of choice for carotid artery stenosis, carotid artery stenting (CAS) with use of proximal protection systems (PPS) plays an very important role as alternative treatment modality, especially in patients with critical, symptomatic lesions. This study was single-centre study to evaluate the technical and clinical success of proximal protection devices as the first choice for embolic protection in symptomatic and asymptomatic carotid stenosis in patients with bilateral, advanced lesions of carotid arteries (bilateral stenoses or stenosis and occlusion). Methods This was a post hoc analysis, with 30-day follow up. We anal…

AdultMalemedicine.medical_specialtymedicine.medical_treatment030204 cardiovascular system & hematologyAsymptomatic03 medical and health sciences0302 clinical medicineDiabetes mellitusAngioplastyOcclusionPost-hoc analysismedicineHumansCarotid StenosisAdverse effectAgedRetrospective StudiesCarotidEndarterectomyProtectionbusiness.industryEndovascular ProceduresAngioplastySystemsProximalangioplastyMiddle Agedprotectionmedicine.diseaseSurgerycarotidStenosisproximalIntracranial EmbolismstentssystemsFemaleStentsSurgeryNeurology (clinical)Radiologymedicine.symptombusiness030217 neurology & neurosurgeryNeurologia i Neurochirurgia Polska
researchProduct

The prevalence of post-thyroidectomy chronic asthenia: a prospective cohort study

2017

Chronic asthenia (CA) is complained by some patients that have undergone thyroid surgery. We evaluate its impact in patients undergoing unilateral or bilateral thyroidectomy, the trend during a 1-year follow-up, and the possible risk factors. A prospective, cohort study was carried out on 263 patients scheduled for thyroidectomy from 2012 and 2014. Exclusion criteria were as follows: Graves’ disease, malignancies requiring radioiodine therapy, post-surgical hypoparathyroidism, laryngeal nerve palsy, abnormal pre- and post-operative thyroid hormone levels, and BMI outside the normal range. Demographics; smoking and alcoholism addiction; cardiac, pulmonary, renal, and hepatic failure; diabete…

AdultMalemedicine.medical_specialtymedicine.medical_treatment030209 endocrinology & metabolismCohort Studies03 medical and health sciencesPostoperative Complications0302 clinical medicineRisk FactorsInternal medicineHemithyroidectomyPrevalencemedicineHumansRisk factorTotal thyroidectomyProspective cohort studyFatigueDepression (differential diagnoses)AgedChronic astheniabusiness.industryThyroidectomyMiddle Agedmedicine.diseaseThyroid DiseasesSurgeryCardiac surgerySettore MED/18 - Chirurgia GeneraleTreatment OutcomeHypoparathyroidismAsthenia030220 oncology & carcinogenesisChronic DiseaseThyroidectomyFemaleSurgerybusinessAbdominal surgeryCohort studyChronic asthenia; Fatigue; Hemithyroidectomy; Total thyroidectomy; Surgery
researchProduct

Impact of Extended-Criteria Donor Liver Grafts on Benchmark Metrics of Clinical Outcome After Liver Transplantation: A Single Center Experience.

2020

Abstract Background The adoption of extended criteria for donors remains the best strategy to widen the pool of available liver graft against the chronic shortage of donors. Benchmarking in liver transplantation (LT) offers the unprecedented opportunity to compare clinical outcome measures to a set of validated reference values. We aimed to evaluate the impact of marginal grafts usage in a cohort of low-risk benchmark cases from an area with a very low rate of deceased donation. Methods A cohort of low-risk benchmark cases was identified from all adult patients who underwent LT at our center. Among these patients, those transplanted with a graft from an extended-criteria donor (ECD) were id…

AdultMalemedicine.medical_specialtymedicine.medical_treatment030230 surgeryLiver transplantationSingle Centerlaw.inventionDonor Selection03 medical and health sciences0302 clinical medicinePostoperative ComplicationslawRisk FactorsmedicineLiving DonorsHumansRetrospective StudiesTransplantationDonor selectionbusiness.industryIncidenceGraft SurvivalPostoperative complicationRetrospective cohort studyMiddle Agedmedicine.diseasePrognosisIntensive care unitSurgeryLiver TransplantationBenchmarkingHepatocellular carcinomaCohort030211 gastroenterology & hepatologySurgeryFemalebusinessTransplantation proceedings
researchProduct

Incidence of heterotopic ossification in minimally invasive short-stem THA using the modified anterolateral approach.

2017

Introduction Heterotopic ossification (HO) is known to be a common complication after total hip arthroplasty (THA). The minimal invasive (MIS) modified anterolateral approach has become popular in combination with a short stem. We analysed the incidence of HO following short-stem THA using this approach in combination with a postoperative administration of nonsteroidal anti-inflammatory drugs (NSAIDs). Materials and methods 216 short stems were implanted in 162 patients. NSAIDs were administered for 2 weeks after surgery in 154 patients (95.1%). Standardised pre- and postoperative radiographic imaging was done at 2-year follow-up. HO was analysed according to the Brooker classification. Inf…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentArthroplasty Replacement HipOsteoarthritisProsthesis DesignRisk AssessmentOsteoarthritis HipBody Mass IndexCohort Studies03 medical and health sciences0302 clinical medicineSex FactorsmedicineHumansMinimally Invasive Surgical ProceduresOrthopedics and Sports Medicine030212 general & internal medicineAgedPain MeasurementRetrospective StudiesHip surgeryPostoperative Care030222 orthopedicsShort stemOssificationbusiness.industryIncidence (epidemiology)IncidenceOssification HeterotopicAnti-Inflammatory Agents Non-SteroidalAge FactorsRecovery of FunctionMiddle Agedmedicine.diseaseArthroplastySurgeryPatient SatisfactionSurgeryHeterotopic ossificationFemaleHip Prosthesismedicine.symptombusinessComplicationHip international : the journal of clinical and experimental research on hip pathology and therapy
researchProduct

Exercise intensity progression for exercises performed on unstable and stable platforms based on ankle muscle activation.

2013

Ankle sprains are a common sports injury. The literature focuses on the application of neuromuscular training for the improvement of balance, injury prevention and rehabilitation. However, there is a dearth of knowledge about the appropriate prescription of exercises using unstable platforms and surfaces. The purpose of this study was to devise an ankle rehabilitation or training program with exercise progression based on the extent of muscle activation, employing platforms with different levels of stability and additional resistance. A descriptive study of electromyography (EMG) during ankle exercises was performed with a convenience sample of healthy subjects. Forty-four subjects complete…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentBiophysicsPoison controlElectromyographyYoung AdultPhysical medicine and rehabilitationPeroneus longusmedicineHumansOrthopedics and Sports MedicineAnkle InjuriesMuscle SkeletalExercisePostural BalanceBalance (ability)Rehabilitationmedicine.diagnostic_testProprioceptionbusiness.industryElectromyographyRehabilitationExercise Therapymedicine.anatomical_structureExercise intensityPhysical therapyFemaleAnkleAnklebusinessAnkle JointMuscle ContractionGaitposture
researchProduct

Factors Influencing Morbidity and Mortality after Pancreaticoduodenectomy: Critical Analysis of 221 Resections

1999

A critical analysis of morbidity and mortality for pancreatico-duodenectomy was performed on 221 patients. During the 1960s and 1970s, the morbidity and mortality for pancreaticoduodenectomy were so high that many thought the operative procedure ought to be abandoned. During the 1980s, however, many centers reported mortality rates around 5% and a morbidity of 25% to 35%. Others still reported a mortality of more than 10% and a morbidity of up to 65%. The reasons for these discrepancies are of major interest. In a prospective case-control study 760 patients with malignant and benign diseases of the pancreas were treated in our hospital between September 1, 1985 and April 30, 1997. In 221 ca…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentBlood Loss SurgicalPancreaticoduodenectomyPostoperative ComplicationsmedicineHumansProspective StudiesSurvival rateAgedAged 80 and overPancreatic ductPortal Veinbusiness.industryPatient SelectionGeneral surgeryMortality ratePancreatic DuctsPancreatic DiseasesBilirubinMiddle AgedVascular surgeryPancreaticoduodenectomyCardiac surgerySurgeryPancreatic NeoplasmsSurvival Ratemedicine.anatomical_structureCardiothoracic surgeryCase-Control StudiesRegression AnalysisFemaleSurgeryClinical CompetencebusinessFollow-Up StudiesAbdominal surgeryWorld Journal of Surgery
researchProduct