Search results for "PreP"

showing 10 items of 1334 documents

For a real job? : Views on the teaching of competence in working life by students with Autism Spectrum Disorder (ASD)

2021

In this study, twelve young students on the autism spectrum were interviewed on preparation for working life, employment guidance, the challenges and strengths of the autism spectrum, and suitable teaching methods. Interviews were supported by a structured and illustrated questionnaire. The data were analysed using key statistics. The results showed that, from the students’ perspective, the most important issues in preparation for work are familiarisation with different jobs, guidance in searching for a suitable job, evaluation of the suitability of the working environment, integration of occupational safety into work skills, and acquiring conversational skills in the workplace. The selecti…

ammatillinen koulutusLC8-6691opiskelijatpreparatory educationcommunicationtyöllistyminenautismikirjon häiriötSpecial aspects of educationviestintätaidotemploymentComputingMilieux_COMPUTERSANDEDUCATIONautism spectrum disorder (ASD)participationtyöelämävalmiudetosallistuminenvalmistava opetus
researchProduct

Urīnceļu infekciju izraisošo gram-negatīvo baktēriju jutība pret antibakteriālajiem līdzekļiem

2017

Aktualitāte: Urīnceļu infekcijas ir vienas no izplatītākajām infekcijām. Visbiežākie ierosinātāji ir gramnegatīvās baktērijas. Ar katru gadu palielinās šo baktēriju rezistence pret antibakteriālajiem līdzekļiem. Tas rada nopietnas problēmas pacientu ārstēšanā. Tāpēc, mana Bakalaura darba mērķis bija: noteikt antibakteriālo jutību gramnegatīvo baktēriju sugām, izmantojot BBLTM disku difūzijas metodi un E – testu, pielietojot CLSI kritērijus, kā arī veikt statistisko analīzi. Laikā no 01.01.2016 – 01.01.2017 tika izdalīti 80 gramnegatīvo baktēriju celmi. No tiem visbiežāk bija identificēti E.coli n-45, Klebsiella pneumoniae n-14. Visefektīvākais antibakteriālais līdzeklis bika amikacīns, jutī…

antibakteriālā rezistenceE-testFarmācijaantibakteriālie preparātigramnegatīvās baktērijas
researchProduct

Prevenzione dell’occlusione delle protesi biliari mediante somministrazione di levofloxacina e acido ursodesossicolico.

2004

One of the main advances in biliopancreatic endoscopic therapy has been the ability to palliate patients with biliary obstruction by placement of a stent during ERCP, but this is often complicated by clogging of the stent with subsequent jaundice and/or cholangitis. Stent clogging may be caused by microbiological adhesion and biliary stasis. Therefore, the use of antibiotics and choleretic agents such as levofloxacin and ursodeoxycholic acid has been investigated to see whether they prolong stent patency. Ninety patients with strictures of the biliary tract and untreatable macrolithiasis with endoscopically inserted stents were randomized into two groups: 49 subjects in group 1 (levofloxaci…

antibiotics reachPharmaceutical PreparationAnti-Bacterial Agent
researchProduct

Effect of post space preparation on apical seal : influence of time interval and sealer

2007

Objective: To assess the efficacy of two sealants to preserve the apical seal after root canal preparation and cementation of posts at 24 h or 72 h after endodontic treatment. Study design: Sixty human single-root teeth were instrumented and obturated using lateral compaction technique with EndoFill® [30] or AH-Plus® [30] and were prepared in one of three ways, leaving a 3 mm gutta percha remnant in all cases: without cast post preparation, with preparation after 24 h or after 72 h. After cementing the posts, the specimens were thermal cycled at 5 and 55?C in water baths, submerged in 2% methylene blue dye for 72 h, embedded in acrylic resin and cut transversally into three 1-mm apical sect…

apical sealUNESCO::CIENCIAS MÉDICASApical leakagepost preparationpost space:CIENCIAS MÉDICAS [UNESCO]
researchProduct

Skābes radītu traucējumu ārstēšanai paredzēto preparātu aprites izvērtējums aptiekā

2022

Ar skābi saistītās slimības ir plaši izplatītas visā pasaulē. Katru gadu pieaug to ārstēšanai paredzēto preparātu patēriņš. Darba mērķis bija izpētīt skābes radītu traucējumu ārstēšanai paredzēto preparātu apriti aptiekā un ar neracionālu to lietošanu saistītās problēmas. Rezultāti liecina, ka ar skābi saistīto slimību ārstēšanā vairāk tiek lietoti protona sūkņa inhibitori un tieši bezrecepšu preparāti, no kuriem populārākā preparātu aktīvā viela ir omeprazols un medikaments Omeira 20 mg zarnās šķīstošās kapsulas; pieprasītākā recepšu medikamentu aktīvā viela – pantoprazols, un medikaments Nolpaza 20 mg zarnās šķīstošās tabletes. Aptaujā secināts, ka nevienu no blakusparādībām neizraisa zāļ…

ar skābi saistītās slimībasprotona sūkņa inhibitoripreparātu apriteblakusparādībasFarmācijaneracionāla zāļu lietošana
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Creencias de autoeficacia docente en estudiantes de magisterio:análisis de su relación con variables de personalidad y bienestar psicológico y estudi…

2015

La autoeficacia docente es uno de los principales predictores y mediadores de la calidad profesional y del desempeño docente futuro (Bandura, 1987). Además, ejerce una notable influencia en la calidad de la actuación docente (Danielson, 2011; Wheatley, 2005), determinando, en cierto modo, qué tareas se deciden emprender, cuánto esfuerzo se empleará y durante cuánto tiempo se persistirá a pesar de las dificultades (Bandura, 1977a). Por ello, en este estudio se plantea un doble objetivo, por un lado, examinar los datos relativos a las creencias de autoeficacia docente en estudiantes de Magisterio españoles y su relación con variables de personalidad y bienestar psicológico. Por otro lado, y d…

autoeficacia docentepersonalidad:PSICOLOGÍA [UNESCO]programas de preparación docente inicialbienestar psicológicoUNESCO::PSICOLOGÍAcalidad educativa
researchProduct

Liquidation of the Bankruptcy Estate in Poland

2020

The purpose of this study is to present the general principles and general issues of liquidation of the bankruptcy estate under Polish law. It should be stressed that liquidation of the bankruptcy estate is intended to satisfy the creditors of the insolvent debtor. Therefore, the manner of liquidation of the bankruptcy estate has an obvious impact on the final bankruptcy dividend for the creditors. The rules governing the liquidation of the bankrupt’s assets are of the key-importance for the theory of law and the practice. The article defines the directional principles of liquidation of the bankruptcy estate, procedure of liquidation of the bankruptcy estate. The subject of this paper there…

bankruptcy lawInsolvencyinsolvencyCreditorCommercial lawPharmaceutical Sciencebankruptcy estate050602 political science & public administrationcivil lawPharmacology (medical)trusteeliquidation0505 law050502 lawFinancebusiness.industryLaw of Europe05 social sciencesDebtorKKJ-KKZ0506 political sciencebankruptcyPolish lawComplementary and alternative medicineBankruptcyCivil law (legal system)DividendEstatebusinesscommercial lawLawlex consursusprepared liquidationBratislava Law Review
researchProduct

Increased Gamma Connectivity in the Human Prefrontal Cortex during theBereitschaftspotential

2017

The Bereitschaftspotential (BP) is a slow negative cortical potential preceding voluntary movement. Since movement preparation is dependent upon the synchronous activity of a variety of neurons, BP may develop through the exchange of information among motor-related neurons. However, the relationship between BP and information flow is not yet well-known. In the present study, we aimed to investigate how the connectivity in the prefrontal cortex (PFC) changes during the occurrence of BP. Electrocorticography (ECoG) was recorded in five patients with epilepsy. The subjects performed self-paced hand grasping. We compared the intraregional connectivity between PFC and non-PFC regions using parti…

beta and gamma bandelectrocorticography (ECoG)Bereitschaftspotential; readiness potential; electrocorticography(ECoG); connectivity; Partial directed coherence (PDC); prefrontalcortex; movement preparation; beta and gamma band050105 experimental psychologylcsh:RC321-57103 medical and health sciencesBehavioral Neuroscience0302 clinical medicinemedicine0501 psychology and cognitive sciencesPrefrontal cortexlcsh:Neurosciences. Biological psychiatry. NeuropsychiatryElectrocorticographyBiological PsychiatryOriginal Researchprefrontal cortexreadiness potentialmedicine.diagnostic_testmovement preparation05 social sciencesBereitschaftspotentialPsychiatry and Mental healthNeuropsychology and Physiological PsychologyNeurologynervous systemBereitschaftspotentialconnectivityPsychologyNeuroscienceGamma bandPartial directed coherence (PDC)030217 neurology & neurosurgeryNeuroscience
researchProduct

An in vitro tool to assess cytochrome P450 drug biotransformation-dependent cytotoxicity in engineered HepG2 cells generated by using adenoviral vect…

2011

Many adverse drug reactions leading to hepatotoxicity are caused by the cytochrome P450-dependent activation of non-toxic drugs or chemicals into reactive metabolites. To this end, adenoviruses were used as a tool to efficiently deliver specific CYP genes into cultured cells (i.e., human hepatoma cell line HepG2). Recombinant-defective adenoviral vectors encoding for genes CYP3A4 (Adv-CYP3A4), CYP2E1 (Adv-CYP2E1), CYP2A6 (Adv-CYP2A6) and CYP1A2 (Adv-CYP1A2) were used to confer specific CYP drug metabolic capabilities to HepG2 cells. Upgraded cells transiently expressed single specific cytochrome P450 enzymatic activities in terms of the number of the infecting virus particles used in their …

biologyCYP3A4Cell SurvivalGenetic VectorsCYP1A2Cytochrome P450Hep G2 CellsGeneral MedicineCYP2E1ToxicologyMolecular biologyAdenoviridaeTransduction (genetics)Cytochrome P-450 Enzyme SystemPharmaceutical PreparationsTransduction GeneticToxicity Tests Acutebiology.proteinHumansMTT assayViability assayCytotoxicityBiotransformationToxicology in Vitro
researchProduct