Search results for "Preparation"

showing 10 items of 939 documents

Application of seaweeds to develop new food products with enhanced shelf-life, quality and health-related beneficial properties

2017

International audience; Edible seaweeds are a good source of antioxidants, dietary fibers, essential amino acids, vitamins, phytochemicals, polyunsaturated fatty acids, and minerals. Many studies have evaluated the gelling, thickening and therapeutic properties of seaweeds when they are used individually. This review gives an overview on the nutritional, textural, sensorial, and health-related properties of food products enriched with seaweeds and seaweed extracts. The effect of seaweed incorporation on properties of meat, fish, bakery, and other food products were highlighted in depth. Moreover, the positive effects of foods enriched with seaweeds and seaweed extracts on different lifestyl…

[SDV.BIO]Life Sciences [q-bio]/BiotechnologyTime Factors[SDV]Life Sciences [q-bio]OrganolepticOrganoleptic propertiesBiologyShelf lifeAntioxidants0404 agricultural biotechnologyAnti-Infective AgentsFood PreservationAnimalsHumans[SPI.GPROC]Engineering Sciences [physics]/Chemical and Process EngineeringColloidsFood scienceDiet Fat-RestrictedCaloric RestrictionTextural propertieschemistry.chemical_classificationbusiness.industryNutritional propertiesHealth related04 agricultural and veterinary sciencesSeaweed040401 food scienceBiotechnologyFood productsFood StoragechemistryFood productsDietary SupplementsFood PreservativesFish <Actinopterygii>Plant PreparationsThickeningDiet Healthybusiness[SDV.AEN]Life Sciences [q-bio]/Food and NutritionNutritive ValueFood SciencePolyunsaturated fatty acidFood Research International
researchProduct

Le passage de Haies: De la réalité sportive en heptathlon à la réalité subjective d'Emma

2006

The major dimension of this article is to point out the importance of psychological follow-up with sporting teenagers. Emma's example illustrates the inherent transitions from this period of age in the specific context of the high level sport. For Emma, the passage of hurdle becomes the metaphor of its psychical conflict. The counter performance which appears in the passage of hurdle announces its ambivalence with regard to its personal history within realities of sport cultures. This making sense of the sporting problems within the framework of the psychological follow-up can help to exceed this difficulty of passage and to support its engagement like subject of its own desire on the way o…

[SHS.PSY] Humanities and Social Sciences/Psychology[ SHS.PSY ] Humanities and Social Sciences/PsychologyPsychological follow-upTransitions[SHS.PSY]Humanities and Social Sciences/PsychologyPsychological preparationSuivi psychologiquePréparation psychologiqueAdolescenceSport
researchProduct

Prevenzione dell’occlusione delle protesi biliari mediante somministrazione di levofloxacina e acido ursodesossicolico.

2004

One of the main advances in biliopancreatic endoscopic therapy has been the ability to palliate patients with biliary obstruction by placement of a stent during ERCP, but this is often complicated by clogging of the stent with subsequent jaundice and/or cholangitis. Stent clogging may be caused by microbiological adhesion and biliary stasis. Therefore, the use of antibiotics and choleretic agents such as levofloxacin and ursodeoxycholic acid has been investigated to see whether they prolong stent patency. Ninety patients with strictures of the biliary tract and untreatable macrolithiasis with endoscopically inserted stents were randomized into two groups: 49 subjects in group 1 (levofloxaci…

antibiotics reachPharmaceutical PreparationAnti-Bacterial Agent
researchProduct

Effect of post space preparation on apical seal : influence of time interval and sealer

2007

Objective: To assess the efficacy of two sealants to preserve the apical seal after root canal preparation and cementation of posts at 24 h or 72 h after endodontic treatment. Study design: Sixty human single-root teeth were instrumented and obturated using lateral compaction technique with EndoFill® [30] or AH-Plus® [30] and were prepared in one of three ways, leaving a 3 mm gutta percha remnant in all cases: without cast post preparation, with preparation after 24 h or after 72 h. After cementing the posts, the specimens were thermal cycled at 5 and 55?C in water baths, submerged in 2% methylene blue dye for 72 h, embedded in acrylic resin and cut transversally into three 1-mm apical sect…

apical sealUNESCO::CIENCIAS MÉDICASApical leakagepost preparationpost space:CIENCIAS MÉDICAS [UNESCO]
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Increased Gamma Connectivity in the Human Prefrontal Cortex during theBereitschaftspotential

2017

The Bereitschaftspotential (BP) is a slow negative cortical potential preceding voluntary movement. Since movement preparation is dependent upon the synchronous activity of a variety of neurons, BP may develop through the exchange of information among motor-related neurons. However, the relationship between BP and information flow is not yet well-known. In the present study, we aimed to investigate how the connectivity in the prefrontal cortex (PFC) changes during the occurrence of BP. Electrocorticography (ECoG) was recorded in five patients with epilepsy. The subjects performed self-paced hand grasping. We compared the intraregional connectivity between PFC and non-PFC regions using parti…

beta and gamma bandelectrocorticography (ECoG)Bereitschaftspotential; readiness potential; electrocorticography(ECoG); connectivity; Partial directed coherence (PDC); prefrontalcortex; movement preparation; beta and gamma band050105 experimental psychologylcsh:RC321-57103 medical and health sciencesBehavioral Neuroscience0302 clinical medicinemedicine0501 psychology and cognitive sciencesPrefrontal cortexlcsh:Neurosciences. Biological psychiatry. NeuropsychiatryElectrocorticographyBiological PsychiatryOriginal Researchprefrontal cortexreadiness potentialmedicine.diagnostic_testmovement preparation05 social sciencesBereitschaftspotentialPsychiatry and Mental healthNeuropsychology and Physiological PsychologyNeurologynervous systemBereitschaftspotentialconnectivityPsychologyNeuroscienceGamma bandPartial directed coherence (PDC)030217 neurology & neurosurgeryNeuroscience
researchProduct

An in vitro tool to assess cytochrome P450 drug biotransformation-dependent cytotoxicity in engineered HepG2 cells generated by using adenoviral vect…

2011

Many adverse drug reactions leading to hepatotoxicity are caused by the cytochrome P450-dependent activation of non-toxic drugs or chemicals into reactive metabolites. To this end, adenoviruses were used as a tool to efficiently deliver specific CYP genes into cultured cells (i.e., human hepatoma cell line HepG2). Recombinant-defective adenoviral vectors encoding for genes CYP3A4 (Adv-CYP3A4), CYP2E1 (Adv-CYP2E1), CYP2A6 (Adv-CYP2A6) and CYP1A2 (Adv-CYP1A2) were used to confer specific CYP drug metabolic capabilities to HepG2 cells. Upgraded cells transiently expressed single specific cytochrome P450 enzymatic activities in terms of the number of the infecting virus particles used in their …

biologyCYP3A4Cell SurvivalGenetic VectorsCYP1A2Cytochrome P450Hep G2 CellsGeneral MedicineCYP2E1ToxicologyMolecular biologyAdenoviridaeTransduction (genetics)Cytochrome P-450 Enzyme SystemPharmaceutical PreparationsTransduction GeneticToxicity Tests Acutebiology.proteinHumansMTT assayViability assayCytotoxicityBiotransformationToxicology in Vitro
researchProduct

Computer-assisted preparation in conference interpreting

2017

Preparation has been proposed in the literature as one of the most important phases of an interpreting assignment, especially if the subject is highly specialised. Preparing an assignment in advance aims at bridging the linguistic and extra-linguistic gap between conference participants and interpreters and at reducing the cognitive load during interpretation. For these reasons it is considered crucial in ensuring higher interpreting quality. Yet, preparation is generally time-consuming and interpreters may often experience the feeling of not knowing exactly how to perform this task efficiently. Information technology could change this. Even though the first computer-assisted interpreting s…

cai toolsLinguistics and LanguageLiterature and Literary TheoryComputer sciencemedia_common.quotation_subjectcomputer.software_genreLanguage and LinguisticsBridging (programming)TerminologySoftwareterminologymedia_common060201 languages & linguisticsbusiness.industrylcsh:Translating and interpretingInformation technology06 humanities and the artslcsh:P306-310Language acquisitionData scienceFeelingcomputer-based interpreter preparation0602 languages and literatureinterpretingbusinesscomputerCognitive loadInterpreterThe International Journal of Translation and Interpreting Research
researchProduct

Effectiveness of a web-based acceptance and commitment therapy program for adolescent career preparation : A randomized controlled trial

2021

Acceptance and commitment therapy (ACT) programs have rarely been used as tools for promoting adolescents' career preparation. This randomized controlled trial examined the possibility to promote the career preparation of Finnish ninth-grade adolescents (n = 249, 49% females) with a web-based five-week ACT-based online intervention program. Participants were randomly assigned to three conditions, of which two groups received an iACT including support via SMS (iACTface: iACT+two face-to-face sessions; only iACT: iACT with no face-to-face sessions) and the third (control) group received no treatment. The results showed that career-related insecurity decreased as a result of the intervention i…

career preparationnuoretonline interventionseducationhyväksymis- ja omistautumisterapiaammatinvalinnanohjausadolescentsurasuunnitteluacceptance and commitment therapy (ACT)interventioverkkopalvelut
researchProduct

Stability and marginal bone loss in implants placed using piezoelectric osteotomy versus conventional drilling: systematic review and meta-analysis.

2021

Background The main objective of this systematic review was to compare primary and secondary implant stability between placement with piezoelectric osteotomy and conventional drilling, comparing marginal bone losses as a secondary objective. Material and Methods An electronic search was conducted using PubMed (MEDLINE), Scopus, and Cochrane Library (Wiley) databases, besides a manual search. Results A total of 153 articles were retrieved, 39 from Pubmed, 44 from Scopus, and 70 from the Cochrane Library. After removing duplicates, 112 articles (1 from the manual search) were screened, and 9 were finally selected for qualitative and statistical analyses. Conclusions Piezoelectric surgery is a…

caveolin-1medicine.medical_treatmentameloblastic carcinomareal-time polymerase chain reactioneducationMEDLINEDentistryReviewImplant stabilityCochrane LibraryOsteotomyOsseointegrationameloblastomaOsseointegrationMedicineHumansPiezosurgeryDental implantGeneral DentistryImplant site preparationUNESCO:CIENCIAS MÉDICASPiezoelectric surgeryDental Implantsbusiness.industryMarginal bone lossDental implantsDental Implantation EndosseousImplant stability quotientOsteotomyOtorhinolaryngologyPiezoelectric surgeryimmunohistochemistrySurgeryImplantbusinessImplantologyConventional drillMedicina oral, patologia oral y cirugia bucal
researchProduct