Search results for "REM"

showing 10 items of 11264 documents

Zabieg medycyny estetycznej w przypadku małoletniego dziecka bez zgody sądu rodzinnego a odpowiedzialność prawnokarna

2017

This article refers to criminal liability for performing aesthetic medicine treatment in a form of plastic surgery without patient’s consent, substitute consent (including collective) or substitute consent of Family Court. Article presents the current state of law in this respect and the correlation between applicable regulations of various branches of law and lex generalis regulations that deal with this issue, i.e. aesthetic medicine treatment.The author evaluates and describes the legal issues related with aesthetic medicine, including the patient’s consent, extended disclosure obligation as well as the ground for statutory liability for committing a prohibited act that is described and …

substitute consent of Family Courtbody deformitiescollective consentextended disclosure obligationconsent of substitute legal representativedeliberate action in the immediate or possible intentionlegality of medical activityperpetratorformal off ence prosecuted on requestcomfort of lifeindividual subject protectionArticle 192 of the Penal Codeconsent of the patientfl aws of declaration of willmedical treatmentaesthetic remedial medicine treatment
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Required competency in organization

2017

Tässä pro gradu – tutkimuksessa tarkoituksena on selvittää mitä kompenssivaatimuksia data analytiikassa on ja mitkä kompetenssit ovat tärkeimpiä asiakkaalle luodun arvon kannalta. Tutkimuksessa on hyödynnetty mixed method – lähestymistapaa, jossa yhdistetään määrillisen ja laadullisen tutkimuksen elementtejä. Empiirinen tutkimus pohjautuu kirjallisuuskatsauksen tuloksiin. Empiirinen tutkimus toteutettiin sähköisin kyselylomakkein, jotka sisälsivät sekä strukturoituja että avoimia kysymyksiä. Tutkimukseen osallistui 18 henkilöä kolmesta eri yrityksestä. Strukturoitujen kysymysten vastaukset valmisteltiin kuvailevien tilastomenetelmien avulla ja analysoitiin verraten löydöksiä kirjallisuuskat…

suorituskykyorganizational performanceorganisaatioanalyysianalyticskompetenssicompetency requirements
researchProduct

Joint Subcarrier and Phase Shifts Optimization for RIS-aided Localization-Communication System

2022

Joint localization and communication systems have drawn significant attention due to their high resource utilization. In this paper, we consider a reconfigurable intelligent surface (RIS)-aided simultaneously localization and communication system. We first determine the sum squared position error bound (SPEB) as the localization accuracy metric for the presented localization-communication system. Then, a joint RIS discrete phase shifts design and subcarrier assignment problem is formulated to minimize the SPEB while guaranteeing each user’s achievable data rate requirement. For the presented non-convex mixed-integer problem, we propose an iterative algorithm to obtain a suboptimal solution …

suorituskykysijaintireconfigurable intelligent surfaceslocation awarenessjoint localization and communication subcarrier assignmentpaikannussystem performancelangaton tekniikkacommunication systemssimulationviestintätekniikkaRIS phase shifts designlangaton tiedonsiirtosimulointimeasurementvehicular and wireless technologiestietojärjestelmät2022 IEEE 95th Vehicular Technology Conference: (VTC2022-Spring)
researchProduct

Thermoelectric radiation detector based on a superconductor-ferromagnet junction : Calorimetric regime

2018

We study the use of a thermoelectric junction as a thermal radiation detector in the calorimetric regime, where single radiation bursts can be separated in time domain. We focus especially on the case of a large thermoelectric figure of merit ZT affecting significantly, for example, the relevant thermal time scales. This work is motivated by the use of hybrid superconductor/ferromagnet systems in creating an unprecedentedly high low-temperature ZT even exceeding unity. Besides constructing a very general noise model which takes into account cross correlations between charge and heat noise, we show how the detector signal can be efficiently multiplexed by the use of resonant LC circuits givi…

superconducting filmsthermodynamic measurements and instrumentationradiation detectorssignaalinkäsittelyilmaisimetinductorsferromagnetic materialsquasiparticlelämpösäteilytelecommunications engineeringfononitsuprajohteet
researchProduct

Observational constraints on the modelling of SN 1006

2011

supernova remnantsISM: individual: SN 1006radiation mechanisms: non-thermalacceleration of particlecosmic ray
researchProduct

Il comportamento dei suprematisti bianchi: un modello sociopsicologico integrato

2021

Un esempio di integrazione assimilativa ed eclettica (ovvero «kitchen sink», espressione in lingua inglese che letteralmente significa «lavello della cucina» e che, in termini metaforici, allude a modelli eterogenei e complessi) è offerto dal modello sociopsicologico integrato del comportamento dei suprematisti bianchi elaborato da Michael P. Arena e Bruce A. Arrigo (2000). Una riflessione sui quattro temi specifici che evidenziano i due autori: il potere, l’identità, genere-maschilità-sessualità e la definizione della situazione che sono letti attraverso tre livelli di analisi e di focus, quello intrapsichico, quello interpersonale e, infine, quello situazionale. An example of assimilative…

suprematismo biancowhite suprematismSettore SPS/12 - Sociologia Giuridica Della Devianza E Mutamento Socialecrimineracismcrimerazzismo
researchProduct

Administración de Surfactante mediante técnica mínimamente invasiva en recién nacidos pretérmino: evaluación de la seguridad y la eficacia

2021

La terapia con surfactante forma parte de la práctica habitual en el manejo del distrés respiratorio en el recién nacido. Su administración ha sido tradicionalmente mediante intubación endotraqueal. Con el fin de minimizar el tiempo de intubación y ventilación mecánica se diseñó la estrategia INSURE (intubación, administración de surfactante y extubación), disminuyendo la posible exposición a la ventilación mecánica. En los últimos años se han investigado nuevas técnicas de administración de surfactante menos invasivas con el objetivo de minimizar los efectos de la intubación traqueal y evitar la aplicación de la ventilación mecánica. El método SONSURE consiste en la administración de surfa…

surfactantesondaprematuridadUNESCO::CIENCIAS MÉDICAS ::Ciencias clínicas::Pediatría:CIENCIAS MÉDICAS ::Ciencias clínicas::Pediatría [UNESCO]intubación
researchProduct

Death and Dying and Cultures of Commemoration - Anders Gustafsson, Cultural studies on death and dying in Scandinavia

2013

surutyöPohjoismaatDyinghautamuistomerkitkuolemakäsityksetCommemorationkuolemarituaalitkirja-arvostelutmuistelukansatiedecultural commemorationseremoniatkulttuurintutkimus
researchProduct

Challenges to the development of energy performance measurement : a systems thinking approach

2016

Growing global energy consumption and its consequent hindrance to sus-tainable development poses one of the greatest challenges of today. Impro-vement of the end-use energy efficiency is commonly regarded as one of the most basic and significant countermeasures for curbing the rising energy needs. However, it seems that the progress of end-use energy management is currently hindered due to the complexities involved in the measurement and management of energy efficiency. In essence, the lack of appropriate energy performance metrics constitute a gap between the current organizational needs and scientific literature. Furthermore, the current scientific debate has questioned whether ener-gy ef…

sustainable developmentkestävä kehitysenergiatehokkuusbarriersmittausEnergy managementsystems thinkingreboundperformance measurementenergy performanceesteetenergianhallintasysteemiajatteluenergy efficiency
researchProduct